Recombinant Human Glypican 1 Protein

Product Discontinued

Recombinant Human Glypican 1 Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acids 1-108 of Human GPC1 partial ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:DPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFG

• Details of Functionality: This protein is not active and should not be used for experiments requiring activity.
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: GPC1

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Glypican 1 Protein

• FLJ38078
• Glypican 1
• glypican proteoglycan 1
• glypican
• glypican-1
• GPC1

Background

GPC1 - glypican 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPC1