Glycogenin 1 Antibody (2C10)

Images

 
Western Blot: Glycogenin 1 Antibody (2C10) [H00002992-M08] - Analysis of GYG1 expression in PC-12 (Cat # L012V1).
Western Blot: Glycogenin 1 Antibody (2C10) [H00002992-M08] - Analysis of GYG1 expression in HepG2 (Cat # L019V1).

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA
Clone
2C10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Glycogenin 1 Antibody (2C10) Summary

Immunogen
GYG1 (NP_004121, 1 a.a. - 73 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLT
Specificity
GYG1 - glycogenin 1 (2C10)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GYG1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Glycogenin 1 Antibody (2C10)

  • EC 2.4.1.186
  • glycogenin 1
  • glycogenin
  • glycogenin-1
  • GN1
  • GN-1
  • GSD15
  • GYG

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-39032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-33194
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88645
Species: Hu
Applications: IHC, IHC-P
NBP1-74102
Species: Mu, ChHa
Applications: WB
NBP2-12900
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Glycogenin 1 Antibody (H00002992-M08) (0)

There are no publications for Glycogenin 1 Antibody (H00002992-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glycogenin 1 Antibody (H00002992-M08) (0)

There are no reviews for Glycogenin 1 Antibody (H00002992-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glycogenin 1 Antibody (H00002992-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glycogenin 1 Products

Bioinformatics Tool for Glycogenin 1 Antibody (H00002992-M08)

Discover related pathways, diseases and genes to Glycogenin 1 Antibody (H00002992-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glycogenin 1 Antibody (H00002992-M08)

Discover more about diseases related to Glycogenin 1 Antibody (H00002992-M08).
 

Pathways for Glycogenin 1 Antibody (H00002992-M08)

View related products by pathway.

Blogs on Glycogenin 1

There are no specific blogs for Glycogenin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glycogenin 1 Antibody (2C10) and receive a gift card or discount.

Bioinformatics

Gene Symbol GYG1
Entrez
Uniprot