Glycogenin 1 Antibody (2C10) - Azide and BSA Free

Western Blot: Glycogenin 1 Antibody (2C10) [H00002992-M08] - Analysis of GYG1 expression in HepG2 (Cat # L019V1).

Western Blot: Glycogenin 1 Antibody (2C10) [H00002992-M08] - Analysis of GYG1 expression in PC-12 (Cat # L012V1).

• Reactivity: Hu, Rt
• Applications: WB, ELISA
• Clone: 2C10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Glycogenin 1 Antibody (2C10) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: GYG1 (NP_004121, 1 a.a. ~ 73 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLT
• Specificity: GYG1 - glycogenin 1 (2C10)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GYG1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Glycogenin 1 Antibody (2C10) - Azide and BSA Free

• EC 2.4.1.186
• glycogenin 1
• glycogenin
• glycogenin-1
• GN1
• GN-1
• GSD15
• GYG

Background

Self-glucosylates, via an inter-subunit mechanism, to form an oligosaccharide primer that serves as substratefor glycogen synthase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GYG1
• Entrez:
  • 2992(Human)
• Uniprot:
  • NP_004121(Human)