Glycogen synthase 2 Antibody - Azide and BSA Free

Western Blot: Glycogen synthase 2 Antibody [NBP3-03770] - Analysis of extracts of mouse liver, using Glycogen synthase 2 antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Glycogen synthase 2 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 594-703 of human Glycogen synthase 2 (NP_068776.2). DLLDWRYLGRYYQHARHLTLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GYS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 80 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for Glycogen synthase 2 Antibody - Azide and BSA Free

• EC 2.4.1.11
• glycogen [starch] synthase, liver
• glycogen synthase 2 (liver)

Background

The protein encoded by the Glycogen synthase 2 gene, liver glycogen synthase, catalyzes the rate-limiting step in the synthesis ofglycogen - the transfer of a glucose molecule from UDP-glucose to a terminal branch of the glycogen molecule.Mutations in this gene cause glycogen storage disease type 0 (GSD-0) - a rare type of early childhood fastinghypoglycemia with decreased liver glycogen content. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: GYS2