GLYATL2 Antibody

Images

 
Western Blot: GLYATL2 Antibody [NBP2-32526] - Analysis of GLYATL2 in human melanoma using anti-GLYATL2 antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: GLYATL2 Antibody [NBP2-32526] - Staining of human salivary gland shows strong cytoplasmic positivity in basal cells in salivary ducts and acini.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GLYATL2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LEEVLSYSNVISWEQTLQIQGCQEGLDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNKEGNFSNMFLDASHAGLVNEHW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLYATL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended. Western Blot reactivity per customer image.
Control Peptide
GLYATL2 Protein (NBP2-32526PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GLYATL2 Antibody

  • Acyl-CoA:glycine N-acyltransferase-like protein 2
  • BXMAS2-10
  • EC 2.3.1.13
  • GATF-B
  • glycine acyltransferase family-B
  • glycine N-acyltransferase-like protein 2
  • glycine-N-acyltransferase-like 2
  • MGC24009

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-84349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88899
Species: Hu
Applications: IHC, IHC-P
NBP1-32600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81310
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-14016
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-46576
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-88686
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58599
Species: Hu
Applications: ICC/IF
26260002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00003757-R07
Species: Hu
NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83279
Species: Hu
Applications: IHC, IHC-P
NBP1-86684
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85326
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GLYATL2 Antibody (NBP2-32526) (0)

There are no publications for GLYATL2 Antibody (NBP2-32526).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLYATL2 Antibody (NBP2-32526) (0)

There are no reviews for GLYATL2 Antibody (NBP2-32526). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLYATL2 Antibody (NBP2-32526) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GLYATL2 Antibody Products

Related Products by Gene

Bioinformatics Tool for GLYATL2 Antibody (NBP2-32526)

Discover related pathways, diseases and genes to GLYATL2 Antibody (NBP2-32526). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLYATL2 Antibody (NBP2-32526)

Discover more about diseases related to GLYATL2 Antibody (NBP2-32526).
 

Pathways for GLYATL2 Antibody (NBP2-32526)

View related products by pathway.

PTMs for GLYATL2 Antibody (NBP2-32526)

Learn more about PTMs related to GLYATL2 Antibody (NBP2-32526).

Blogs on GLYATL2

There are no specific blogs for GLYATL2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLYATL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLYATL2

Customers Who Bought This Also Bought