GLYATL2 Antibody

Images

 
Western Blot: GLYATL2 Antibody [NBP2-32526] - analysis of GLYATL2 in human melanoma using anti-GLYATL2 antibody. Image from verified customer review.
Immunohistochemistry: GLYATL2 Antibody [NBP2-32526] - Urothelial cancer
Immunohistochemistry: GLYATL2 Antibody [NBP2-32526] - Staining of human salivary gland shows strong cytoplasmic positivity in basal cells in salivary ducts and acini.
Immunohistochemistry: GLYATL2 Antibody [NBP2-32526] - Salivary gland

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

GLYATL2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LEEVLSYSNVISWEQTLQIQGCQEGLDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNKEGNFSNMFLDASHAGLVNEHW
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLYATL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Control Peptide
GLYATL2 Protein (NBP2-32526PEP)

Alternate Names for GLYATL2 Antibody

  • Acyl-CoA:glycine N-acyltransferase-like protein 2
  • BXMAS2-10
  • EC 2.3.1.13
  • GATF-B
  • glycine acyltransferase family-B
  • glycine N-acyltransferase-like protein 2
  • glycine-N-acyltransferase-like 2
  • MGC24009

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-84349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88899
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81310
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-14016
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74434
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88686
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31370
Species: Hu, Mu
Applications: WB, ICC/IF
H00051365-T01
Species: Hu
NBP1-19679
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-38797
Species: Hu
Applications: IHC, IHC-P
NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-83279
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-12894
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-85326
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GLYATL2 Antibody (NBP2-32526) (0)

There are no publications for GLYATL2 Antibody (NBP2-32526).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLYATL2 Antibody (NBP2-32526) (0)

There are no reviews for GLYATL2 Antibody (NBP2-32526). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GLYATL2 Antibody (NBP2-32526) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GLYATL2 Antibody Products

Related Products by Gene

Bioinformatics Tool for GLYATL2 Antibody (NBP2-32526)

Discover related pathways, diseases and genes to GLYATL2 Antibody (NBP2-32526). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLYATL2 Antibody (NBP2-32526)

Discover more about diseases related to GLYATL2 Antibody (NBP2-32526).
 

Pathways for GLYATL2 Antibody (NBP2-32526)

View related products by pathway.

PTMs for GLYATL2 Antibody (NBP2-32526)

Learn more about PTMs related to GLYATL2 Antibody (NBP2-32526).

Blogs on GLYATL2

There are no specific blogs for GLYATL2, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol GLYATL2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-32526 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought