Glutathione S-Transferase pi 1/GSTP1 Antibody - BSA Free

Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP3-10136] - Western blot analysis of Glutathione S-Transferase pi 1/GSTP1 in Mouse Spleen lysates. Antibody dilution at 1ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Glutathione S-Transferase pi 1/GSTP1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse Glutathione S-Transferase pi 1/GSTP1 (NP_861461.1). Peptide sequence LIHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPEHVNRPINGNGKQ
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GSTP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Glutathione S-Transferase pi 1/GSTP1 Antibody - BSA Free

• deafness, X-linked 7
• DFN7
• EC 2.5.1.18
• FAEES3
• fatty acid ethyl ester synthase III
• glutathione S-transferase P
• Glutathione STransferase pi 1
• Glutathione S-Transferase pi 1
• GST class-pi
• GST3DFN7
• GSTP
• GSTP1
• GSTP1-1
• PI

Background

GSTP1 (glutathione-S-transferase, pi 1), also called GST3/DFN7, which is located on chromosome 11q13 , is a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. GSTP1 act like a tumor suppressor gene, which when inactivated leads to tumor growth, and the -class glutathione S-transferase is commonly inactivated by somatic CpGisland hypermethylation in cancers of the prostate, liver, and breast. Methylation of regulatory sequences at the GSTP1 gene locus is found in the vast majority (>90%) of prostate carcinomas and is associated with transcriptional down-regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GSTP1