Glutathione Peroxidase 2/GPX2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Glutathione Peroxidase 2/GPX2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Glutathione Peroxidase 2/GPX2
  
  

  Source: E.coli

  Amino Acid Sequence: MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVAS

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: GPX2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24874It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Glutathione Peroxidase 2/GPX2 Recombinant Protein Antigen

• EC 1.11.1
• EC 1.11.1.9
• gastrointestinal glutathione peroxidase 2
• Gastrointestinal glutathione peroxidase
• GIGPX
• GI-GPx
• glutathione peroxidase 2 (gastrointestinal)
• Glutathione Peroxidase 2
• Glutathione peroxidase-gastrointestinal
• Glutathione peroxidase-related protein 2
• GPRP
• GPRP-2
• GPX2
• GPx-2
• GPx-GI
• GSHPx-2
• GSHPX-GI

Background

Glutathione Peroxidase 2 is a member of the glutathione peroxidase family and encodes a selenium-dependent glutathione peroxidase that is one of two isoenzymes responsible for the majority of the glutathione-dependent hydrogen peroxide-reducing activity in the epithelium of the gastrointestinal tract. Studies in knockout mice indicate that mRNA expression levels respond to luminal microflora, suggesting a role of the ileal glutathione peroxidases in preventing inflammation in the GI tract.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPX2