Glutathione Peroxidase 2/GPX2 Recombinant Protein Antigen

Images

 
There are currently no images for Glutathione Peroxidase 2/GPX2 Protein (NBP2-47447PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Glutathione Peroxidase 2/GPX2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPX2.

Source: E. coli

Amino Acid Sequence: VLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GPX2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47447.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Glutathione Peroxidase 2/GPX2 Recombinant Protein Antigen

  • EC 1.11.1
  • EC 1.11.1.9
  • gastrointestinal glutathione peroxidase 2
  • Gastrointestinal glutathione peroxidase
  • GIGPX
  • GI-GPx
  • glutathione peroxidase 2 (gastrointestinal)
  • Glutathione Peroxidase 2
  • Glutathione peroxidase-gastrointestinal
  • Glutathione peroxidase-related protein 2
  • GPRP
  • GPRP-2
  • GPX2
  • GPx-2
  • GPx-GI
  • GSHPx-2
  • GSHPX-GI

Background

Glutathione Peroxidase 2 is a member of the glutathione peroxidase family and encodes a selenium-dependent glutathione peroxidase that is one of two isoenzymes responsible for the majority of the glutathione-dependent hydrogen peroxide-reducing activity in the epithelium of the gastrointestinal tract. Studies in knockout mice indicate that mRNA expression levels respond to luminal microflora, suggesting a role of the ileal glutathione peroxidases in preventing inflammation in the GI tract.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3798
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
MAB5457
Species: Hu, Mu, Rt
Applications: WB
NBP1-06398
Species: Hu, Pm, Rt
Applications: IB, ICC/IF, IHC, IHC-P, WB
NBP1-32105
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NB200-209
Species: Ca, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
MAB7428
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, WB
NB100-74398
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MAB3024
Species: Hu, Mu, Rt
Applications: KO, Simple Western, WB
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, WB

Publications for Glutathione Peroxidase 2/GPX2 Protein (NBP2-47447PEP) (0)

There are no publications for Glutathione Peroxidase 2/GPX2 Protein (NBP2-47447PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glutathione Peroxidase 2/GPX2 Protein (NBP2-47447PEP) (0)

There are no reviews for Glutathione Peroxidase 2/GPX2 Protein (NBP2-47447PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Glutathione Peroxidase 2/GPX2 Protein (NBP2-47447PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Glutathione Peroxidase 2/GPX2 Products

Research Areas for Glutathione Peroxidase 2/GPX2 Protein (NBP2-47447PEP)

Find related products by research area.

Blogs on Glutathione Peroxidase 2/GPX2

There are no specific blogs for Glutathione Peroxidase 2/GPX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Glutathione Peroxidase 2/GPX2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GPX2