Glutamate Receptor 6 Recombinant Protein Antigen

Images

 
There are currently no images for Glutamate Receptor 6 Protein (NBP1-91945PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Glutamate Receptor 6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GRIK2.

Source: E. coli

Amino Acid Sequence: LEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRRLPGKE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GRIK2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91945.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Glutamate Receptor 6 Recombinant Protein Antigen

  • EAA4
  • GLR6
  • GluK2
  • GLUK6
  • GluR6
  • glutamate receptor 6
  • glutamate receptor, ionotropic, kainate 2
  • ionotropic kainate 2
  • MGC74427
  • MRT6

Background

Glutamate receptors mediate most excitatory neurotransmission in the brain and play an important role in neural plasticity, neural development and neurodegeneration. Ionotropic glutamate receptors are categorized into NMDA receptors and kainate/AMPA receptors, both of which contain glutamategated, caution-specific ion channels. Kainate/AMPA receptors are co-localized with NMDA receptors in many synapses and consist of seven structurally related subunits designated GluR-1 to -7. The kainate/AMPA receptors are primarily responsible for the fast excitatory neuro-transmission by glutamate, whereas the NMDA receptors are functionally characterized by a slow kinetic and a high permeability for Ca2+ ions. The NMDA receptors consist of five subunits: epsilion 1, 2, 3, 4 and one zeta subunit. The zeta subunit is expressed throughout the brain stem, whereas the four epsilon subunits display limited distribution.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76849
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-75510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-76853
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-22399
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NLS892
Species: Bt, Bv, Ca, Ha, Hu, Mu, Po, Rb, Rt
Applications: ICC, IHC,  IHC-P, WB
NBP2-61782
Species: Hu
Applications: ELISA, ICC/IF, WB
NLS921
Species: Bv, Hu
Applications: ICC, IHC,  IHC-P, WB
NBP3-17081
Species: Hu
Applications: IHC,  IHC-P
NLS3208
Species: Bv, Eq, Hu, Pm, Po, Pm
Applications: ICC, IHC,  IHC-P, WB
NBP1-02312
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
AF4559
Species: Hu
Applications: WB
NB300-118
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-76851
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: EM, IHC,  IHC-P, WB
NBP1-88790
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00051144-M08
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
NB300-105
Species: Hu, Mu, Rb, Rt
Applications: IHC,  IHC-P, IP, KO, WB
NBP3-26149
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, WB
NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-91856
Species: Hu
Applications: ICC/IF, IHC,  IHC-P

Publications for Glutamate Receptor 6 Protein (NBP1-91945PEP) (0)

There are no publications for Glutamate Receptor 6 Protein (NBP1-91945PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glutamate Receptor 6 Protein (NBP1-91945PEP) (0)

There are no reviews for Glutamate Receptor 6 Protein (NBP1-91945PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Glutamate Receptor 6 Protein (NBP1-91945PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Glutamate Receptor 6 Products

Research Areas for Glutamate Receptor 6 Protein (NBP1-91945PEP)

Find related products by research area.

Blogs on Glutamate Receptor 6

There are no specific blogs for Glutamate Receptor 6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Glutamate Receptor 6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GRIK2