Glucose Transporter GLUT8 Antibody

Images

 
Immunohistochemistry-Paraffin: Glucose Transporter GLUT8 Antibody [NBP1-89760] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glucose Transporter GLUT8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PRFLLTQHRRQEAMAALRFLWGSEQGWEDPPIGAEQSFHLALLRQPGIYKP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC2A8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Glucose Transporter GLUT8 Protein (NBP1-89760PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Glucose Transporter GLUT8 Antibody

  • GLUT-8
  • GLUT8solute carrier family 2 (facilitated glucose transporter) member 8
  • GLUTX1facilitated glucose transporter member 8
  • solute carrier family 2 (facilitated glucose transporter), member 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB1415
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00144195-R01
Species: Hu
NBP1-91944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33382
Species: Hu
Applications: IHC, IHC-P
NBP1-05054
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47980
Species: Hu, Mk
Applications: WB, Flow, IHC, IHC-P, IP
NBP2-20338
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-490
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-1844
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89760
Species: Hu
Applications: IHC, IHC-P

Publications for Glucose Transporter GLUT8 Antibody (NBP1-89760) (0)

There are no publications for Glucose Transporter GLUT8 Antibody (NBP1-89760).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glucose Transporter GLUT8 Antibody (NBP1-89760) (0)

There are no reviews for Glucose Transporter GLUT8 Antibody (NBP1-89760). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Glucose Transporter GLUT8 Antibody (NBP1-89760) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glucose Transporter GLUT8 Products

Bioinformatics Tool for Glucose Transporter GLUT8 Antibody (NBP1-89760)

Discover related pathways, diseases and genes to Glucose Transporter GLUT8 Antibody (NBP1-89760). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glucose Transporter GLUT8 Antibody (NBP1-89760)

Discover more about diseases related to Glucose Transporter GLUT8 Antibody (NBP1-89760).
 

Pathways for Glucose Transporter GLUT8 Antibody (NBP1-89760)

View related products by pathway.

PTMs for Glucose Transporter GLUT8 Antibody (NBP1-89760)

Learn more about PTMs related to Glucose Transporter GLUT8 Antibody (NBP1-89760).

Blogs on Glucose Transporter GLUT8

There are no specific blogs for Glucose Transporter GLUT8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glucose Transporter GLUT8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC2A8