Glucose Transporter GLUT8 Antibody - BSA Free

Immunohistochemistry-Paraffin: Glucose Transporter GLUT8 Antibody [NBP1-89760] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells of seminiferus ducts.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Glucose Transporter GLUT8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Glucose Transporter GLUT8 Antibody - BSA Free (NBP1-89760) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PRFLLTQHRRQEAMAALRFLWGSEQGWEDPPIGAEQSFHLALLRQPGIYKP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC2A8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Glucose Transporter GLUT8 Protein (NBP1-89760PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Glucose Transporter GLUT8 Antibody - BSA Free

• GLUT-8
• GLUT8solute carrier family 2 (facilitated glucose transporter) member 8
• GLUTX1facilitated glucose transporter member 8
• solute carrier family 2 (facilitated glucose transporter), member 8

Background

Glucose transporter 8 is an insulin-regulated facilitative glucose transporter. It binds cytochalasin B in a glucose-inhibitable manner. It appears to be a dual-specific sugar transporter as it can be inhibited by fructose. It is highly expressed in testis, where it is down-regulated by estrogen, but not in testicular carcinoma. Lower amounts are present in most other tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC2A8