GLS2 Antibody [DyLight 550]

Images

 
There are currently no images for GLS2 Antibody (NBP1-54773R).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
DyLight 550

GLS2 Antibody [DyLight 550] Summary

Immunogen
Synthetic peptides corresponding to GLS2(glutaminase 2 (liver, mitochondrial)) The peptide sequence was selected from the middle region of GLS2. Peptide sequence FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Porcine (100%), Rabbit (93%), Bovine (93%), Guinea Pig (93%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLS2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for GLS2 Antibody [DyLight 550]

  • EC 3.5.1.2
  • GAbreast cell glutaminase
  • GLSglutaminase GA
  • glutaminase 2 (liver, mitochondrial)
  • glutaminase I
  • glutaminase liver isoform, mitochondrial
  • hLGA
  • LGA
  • L-glutaminase
  • L-glutamine amidohydrolase
  • MGC71567
  • phosphate-activated glutaminase
  • phosphate-dependent glutaminase
  • truncated glutaminase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94035
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NBP1-84579
Species: Hu
Applications: IHC, IHC-P
NBP1-32482
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67416
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85466
Species: Hu, Mu, Fe
Applications: WB, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF7895
Species: Hu
Applications: WB, IHC
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54773R
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Gp, Rb
Applications: WB, IHC, IHC-P

Publications for GLS2 Antibody (NBP1-54773R) (0)

There are no publications for GLS2 Antibody (NBP1-54773R).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLS2 Antibody (NBP1-54773R) (0)

There are no reviews for GLS2 Antibody (NBP1-54773R). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLS2 Antibody (NBP1-54773R) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Alexa Fluor 350 NBP1-54773AF350
Alexa Fluor 405 NBP1-54773AF405
Alexa Fluor 488 NBP1-54773AF488
Alexa Fluor 532 NBP1-54773AF532
Alexa Fluor 594 NBP1-54773AF594
Alexa Fluor 647 NBP1-54773AF647
Alexa Fluor 700 NBP1-54773AF700
Alexa Fluor 750 NBP1-54773AF750
Biotin NBP1-54773B
DyLight 350 NBP1-54773UV
DyLight 405 NBP1-54773V
DyLight 488 NBP1-54773G
DyLight 550 NBP1-54773R
DyLight 594 NBP1-54773DL594
DyLight 650 NBP1-54773C
DyLight 680 NBP1-54773FR
DyLight 755 NBP1-54773IR
FITC NBP1-54773F
HRP NBP1-54773H
Janelia Fluor 549 NBP1-54773JF549
Janelia Fluor 646 NBP1-54773JF646
PE NBP1-54773PE
PerCP NBP1-54773PCP

Additional GLS2 Products

Bioinformatics Tool for GLS2 Antibody (NBP1-54773R)

Discover related pathways, diseases and genes to GLS2 Antibody (NBP1-54773R). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLS2 Antibody (NBP1-54773R)

Discover more about diseases related to GLS2 Antibody (NBP1-54773R).
 

Pathways for GLS2 Antibody (NBP1-54773R)

View related products by pathway.

PTMs for GLS2 Antibody (NBP1-54773R)

Learn more about PTMs related to GLS2 Antibody (NBP1-54773R).

Blogs on GLS2

There are no specific blogs for GLS2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLS2 Antibody [DyLight 550] and receive a gift card or discount.

Bioinformatics

Gene Symbol GLS2
Entrez
Uniprot