Home » GLS2 » GLS2 Research Products » GLS2 Antibody [DyLight 755]

GLS2 Antibody [DyLight 755]

 Submit a Review

Images

 
There are currently no images for GLS2 Antibody (NBP1-54773IR).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
DyLight 755

Order Details

View Available Conjugates
Catalog# & Conjugate Size Price
Alexa Fluor 350
NBP1-54773AF350
Alexa Fluor 405
NBP1-54773AF405
Alexa Fluor 488
NBP1-54773AF488
Alexa Fluor 532
NBP1-54773AF532
Alexa Fluor 594
NBP1-54773AF594
Alexa Fluor 647
NBP1-54773AF647
Alexa Fluor 700
NBP1-54773AF700
Alexa Fluor 750
NBP1-54773AF750
Biotin
NBP1-54773B
DyLight 350
NBP1-54773UV
DyLight 405
NBP1-54773V
DyLight 488
NBP1-54773G
DyLight 550
NBP1-54773R
DyLight 594
NBP1-54773DL594
DyLight 650
NBP1-54773C
DyLight 680
NBP1-54773FR
FITC
NBP1-54773F
HRP
NBP1-54773H
Janelia Fluor 549
NBP1-54773JF549
Janelia Fluor 646
NBP1-54773JF646
PE
NBP1-54773PE
PerCP
NBP1-54773PCP
Unconjugated
NBP1-54773
100% Guarantee on every product

GLS2 Antibody [DyLight 755] Summary

Immunogen
Synthetic peptides corresponding to GLS2(glutaminase 2 (liver, mitochondrial)) The peptide sequence was selected from the middle region of GLS2. Peptide sequence FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Porcine (100%), Guinea Pig (93%), Bovine (93%), Rabbit (93%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLS2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for GLS2 Antibody [DyLight 755]

  • EC 3.5.1.2
  • GAbreast cell glutaminase
  • GLSglutaminase GA
  • glutaminase 2 (liver, mitochondrial)
  • glutaminase I
  • glutaminase liver isoform, mitochondrial
  • hLGA
  • LGA
  • L-glutaminase
  • L-glutamine amidohydrolase
  • MGC71567
  • phosphate-activated glutaminase
  • phosphate-dependent glutaminase
  • truncated glutaminase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TEF1 Antibody
NBP2-94035
Western Blot: TEF1 Antibody [NBP2-94035] - Analysis of extracts of various cell lines, using TEF1 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 120s.
Immunocytochemistry/Immunofluorescence: TEF1 Antibody [NBP2-94035] - Analysis of extracts of HeLa cell line, using TEF1 rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
Immunohistochemistry-Paraffin: TEF1 Antibody [NBP2-94035] - Paraffin-embedded mouse lung using TEF1.
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(32 Reviews)
(647 Publications)
Species: Hu
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: Albumin Antibody [NB600-41532] - NLRP12 downregulates multiple JNK activating pathways in hepatocytes. For checking the purity of primary hepatocytes, hepatocytes isolated from healthy WT and Nlrp12-/- mouse livers were immunostained with antibody for hepatocyte-specific marker Albumin and counterstained with DAPI. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/40396), licensed under a CC-BY licence.
(38 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
HSP90 alpha
Antibody
NBP1-77685
Western Blot: HSP90 alpha Antibody [NBP1-77685] - Analysis of HSP901a in 1: HeLa. 2: Ntera2. 3: A431. 4: HepG2. 5: MCF7. 6: NIH/3T3. 7: PC12. 8: COS7.
Immunocytochemistry/Immunofluorescence: HSP90 alpha Antibody [NBP1-77685] - HSP901a antibody was tested in MCF-7 cells with FITC (green). Nuclei and actin were counterstained with DAPI (blue) and Phalloidin (red).
Immunohistochemistry: HSP90 alpha Antibody [NBP1-77685] - Staining of human kidney carcinoma in HSP901A using DAB with hematoxylin counterstain.
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
IL-10 [Biotin]
DY417
(6 Reviews)
(186 Publications)
Species: Mu
Recombinant Human
AGA Protein
NBP2-52631
SDS-Page: Recombinant Human AGA Protein [NBP2-52631]
(1 Publication)
Species: Hu
Glutamine
Synthetase Antibody
NB110-41404
Western Blot: Glutamine Synthetase Antibody [NB110-41404] - Analysis of glutamine synthase. 40ug of lysates from mouse (Lanes M), rat (Lane R), pig (Lane P), bovine (Lane B), or human (Lane Hu) retina were probed. A 42 kDa band was identified in lysates from retinas of all species.
Immunocytochemistry/Immunofluorescence: Glutamine Synthetase Antibody [NB110-41404] - Immunofluorescence using NB110-41404. Submitted via verified customer review.
Immunohistochemistry: Glutamine Synthetase Antibody [NB110-41404] - Localization of glutamine synthase in the retina. Paraffin sections of mouse (A, B), rat (C, D, G-I), or human (E, F) retina fixed in 4% paraformaldehyde were reacted with anti-glutamine synthase (red fluorescence staining in B, D, G, I, and brown immuno-peroxidase reaction. Nuclei in IF experiments (A-D) were stained with DAPI (cyan), and with nuclear fast red in E and F. At low magnification, anti-glutamine synthase reacted with a single population of cells extending from the ganglion cell layer through the inner nuclear layer. No signal was detected in controls either pre-incubated with 100ug/ml of the immunizing peptide (A) or with pre-immune serum (C, E). This finding was confirmed by co-localization (indicated by yellow in I) of glutamine synthase (red in G) with antoher marker of glutamine synthase (green in H).
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
IL-6 [HRP]
D6050
(25 Reviews)
(465 Publications)
Species: Hu
Integrin alpha
2b/CD41 Antibody
NBP1-84579
Immunohistochemistry-Paraffin: Integrin alpha 2b/CD41 Antibody [NBP1-84579] - Staining of human bone marrow.
Immunohistochemistry-Paraffin: Integrin alpha 2b/CD41 Antibody [NBP1-84579] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: Integrin alpha 2b/CD41 Antibody [NBP1-84579] - Staining of human stomach shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P
FABP6 Antibody
NBP1-32482
Western Blot: FABP6 Antibody [NBP1-32482] - Sample(30 ug whole cell lysate)A:HeLa S3 B:Hep G2 12% SDS PAGE, antibody diluted at 1:1000.
Immunohistochemistry-Paraffin: FABP6 Antibody [NBP1-32482] - Paraffin-embedded human colon carcinoma. ILBP antibody dilution: 1:500.
Species: Hu
Applications: WB, IHC, IHC-P
Integrin beta
3/CD61 Antibody (SJ19
NBP2-67416
Western Blot: Integrin beta 3/CD61 Antibody (SJ19-09) [NBP2-67416] - Analysis of Integrin beta 3 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature. Positive control: Lane 1: HUVEC cell lysateLane 2: mouse marrow tissue lysate
Immunocytochemistry/Immunofluorescence: Integrin beta 3/CD61 Antibody (SJ19-09) [NBP2-67416] - Staining Integrin beta 3 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilized with 0.25% Triton X-100/PBS.
Immunohistochemistry-Paraffin: Integrin beta 3/CD61 Antibody (SJ19-09) [NBP2-67416] - Mouse lung tissue. IF-stained paraffin section. Image from verified customer review.
(2 Reviews)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
CD55/DAF Antibody
NBP1-85466
Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining in human lung and kidney tissues using anti-CD55 antibody. Corresponding CD55 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining of human lung shows high expression.
(2 Publications)
Species: Hu, Mu, Fe
Applications: WB, IHC, IHC-P
Pancreatic Amylase
Alpha Antibody (OTI6D ...
NBP1-47659
Western Blot: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Pancreatic Amylase(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Pancreatic Amylase.
Immunohistochemistry-Paraffin: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) Staining of paraffin-embedded ovary using anti-Pancreatic Amylase mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) Staining of paraffin-embedded Adenocarcinoma of breast using anti-Pancreatic Amylase mouse monoclonal antibody.
(1 Review)
Species: Hu
Applications: WB, IHC, IHC-P
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Transcobalamin II
Antibody
AF7895
Western blot shows lysates of HUVEC human umbilical vein endothelial cells and RPMI 8226 human multiple myeloma cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse/Rat Transcobalamin II Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7895) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Transcobalamin II at approximately 43 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Transcobalamin II was detected in immersion fixed paraffin-embedded sections of human kidney using Sheep Anti-Human/Mouse/Rat Transcobalamin II Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7895) at 10 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to the cytoplasm in epithelial cell convoluted tubules. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC
LIGHT/TNFSF14
[Unconjugated]
664-LI/CF
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(16 Publications)
Species: Hu
VEGF [HRP]
DVE00
(26 Reviews)
(514 Publications)
Species: Hu
Sialin/SLC17A5
Antibody
NBP2-20383
Western Blot: SLC17A5 Antibody [NBP2-20383] - Sample (30 ug of whole cell lysate) A: Jurkat 10% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: SLC17A5 Antibody [NBP2-20383] - Sample: HepG2 cells were fixed in -20C 100% MeOH for 5 min. Green: SLC17A5 protein stained by SLC17A5 antibody diluted at 1:500. Blue: Hoechst 33343 staining.
Immunohistochemistry-Paraffin: Sialin/SLC17A5 Antibody [NBP2-20383] - Mouse lung diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
GLS2 Antibody
[DyLight 755]
NBP1-54773IR
GLS2 Antibody [DyLight 755]
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Gp, Rb
Applications: WB, IHC, IHC-P

Publications for GLS2 Antibody (NBP1-54773IR) (0)

There are no publications for GLS2 Antibody (NBP1-54773IR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLS2 Antibody (NBP1-54773IR) (0)

There are no reviews for GLS2 Antibody (NBP1-54773IR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLS2 Antibody (NBP1-54773IR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Alexa Fluor 350 NBP1-54773AF350
Alexa Fluor 405 NBP1-54773AF405
Alexa Fluor 488 NBP1-54773AF488
Alexa Fluor 532 NBP1-54773AF532
Alexa Fluor 594 NBP1-54773AF594
Alexa Fluor 647 NBP1-54773AF647
Alexa Fluor 700 NBP1-54773AF700
Alexa Fluor 750 NBP1-54773AF750
Biotin NBP1-54773B
DyLight 350 NBP1-54773UV
DyLight 405 NBP1-54773V
DyLight 488 NBP1-54773G
DyLight 550 NBP1-54773R
DyLight 594 NBP1-54773DL594
DyLight 650 NBP1-54773C
DyLight 680 NBP1-54773FR
DyLight 755 NBP1-54773IR
FITC NBP1-54773F
HRP NBP1-54773H
Janelia Fluor 549 NBP1-54773JF549
Janelia Fluor 646 NBP1-54773JF646
PE NBP1-54773PE
PerCP NBP1-54773PCP
Learn about Custom Antibody Labeling

Additional GLS2 Products

Bioinformatics Tool for GLS2 Antibody (NBP1-54773IR)

Discover related pathways, diseases and genes to GLS2 Antibody (NBP1-54773IR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLS2 Antibody (NBP1-54773IR)

Discover more about diseases related to GLS2 Antibody (NBP1-54773IR).
 

Pathways for GLS2 Antibody (NBP1-54773IR)

View related products by pathway.

PTMs for GLS2 Antibody (NBP1-54773IR)

Learn more about PTMs related to GLS2 Antibody (NBP1-54773IR).

Blogs on GLS2

There are no specific blogs for GLS2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLS2 Antibody [DyLight 755] and receive a gift card or discount.


Bioinformatics

Gene Symbol GLS2
Entrez
Uniprot