GLRB Antibody


Western Blot: GLRB Antibody [NBP2-84980] - Host: Rabbit. Target Name: GLRB. Sample Type: Fetal Lung lysates. Antibody Dilution: 1.0ug/ml

Product Details

Reactivity Hu, Rt, Po, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB

Order Details

GLRB Antibody Summary

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GLRB. Peptide sequence: LLTTAFLILISLWVEEAYSKEKSSKKGKGKKKQYLCPSQQSAEDLARVPA The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (100%), Porcine (100%), Bovine (100%), Guinea Pig (93%), Rabbit (100%), Canine (100%), Equine (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for GLRB Antibody

  • beta subunit
  • Glycine receptor 58 kDa subunit
  • glycine receptor, beta


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, TCS
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Mu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, ChIP
Species: Hu, Rt, Ha
Applications: WB, IHC, IHC-P, IP, PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt, Po, Bv, Ca, Eq, Gp, Rb
Applications: WB

Publications for GLRB Antibody (NBP2-84980) (0)

There are no publications for GLRB Antibody (NBP2-84980).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLRB Antibody (NBP2-84980) (0)

There are no reviews for GLRB Antibody (NBP2-84980). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLRB Antibody (NBP2-84980) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional GLRB Products

Bioinformatics Tool for GLRB Antibody (NBP2-84980)

Discover related pathways, diseases and genes to GLRB Antibody (NBP2-84980). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLRB Antibody (NBP2-84980)

Discover more about diseases related to GLRB Antibody (NBP2-84980).

Pathways for GLRB Antibody (NBP2-84980)

View related products by pathway.

PTMs for GLRB Antibody (NBP2-84980)

Learn more about PTMs related to GLRB Antibody (NBP2-84980).

Blogs on GLRB

There are no specific blogs for GLRB, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GLRB Antibody and receive a gift card or discount.


Gene Symbol GLRB