GLP/EHMT1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

GLP/EHMT1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GLP/EHMT1
  
  

  Source: E. coli

  Amino Acid Sequence: DCVVLFLSRDSDVTLKNKEGETPLQCASLNSQVWSALQMSKALQDSAPDRPSPVERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYV

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: EHMT1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17670.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GLP/EHMT1 Recombinant Protein Antigen

• DEL9q34
• EC 2.1.1.-
• EC 2.1.1.43
• EHMT1
• euchromatic histone-lysine N-methyltransferase 1H3-K9-HMTase 5
• Eu-HMTase1
• Eu-HMTase1DEL9q34
• EUHMTASE1FP13812
• FLJ12879
• G9a-like protein 1
• GLP
• GLP1
• H3 lysine-9 specific 5
• KIAA1876euchromatic histone methyltransferase 1
• KMT1D
• KMT1DDKFZp667M072
• Lysine N-methyltransferase 1D

Background

Euchromatic histone-lysine N-methyltransferase 1 (EHMT1) is a histone methyltransferase that catalyzes the methylation of lysine-9 of histone H3 (H3-K9). H3-K9 histone methylation is restricted to euchromatin and functions to epigenetically silence gene transcription. Loss of function mutations in EHMT1 cause the 9q34 subtelomeric deletion syndrome, a syndrome characterized by severe mental retardation, hypotonia, brachy(micro)cephaly, heart defects, and distinct facial anomalies. Alternate names for EHMT1 include histone H3-K9 methyltransferase 5, H3-K9-HMTase5, eu-HMTase, G9a-like protein 1, GLP1, lysine N-methyltransferase 1D, EUHMTASE1, KMT1D, and KIAA1876.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: EHMT1