GLP/EHMT1 Recombinant Protein Antigen

Images

 
There are currently no images for GLP/EHMT1 Recombinant Protein Antigen (NBP3-17670PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GLP/EHMT1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GLP/EHMT1

Source: E. coli

Amino Acid Sequence: DCVVLFLSRDSDVTLKNKEGETPLQCASLNSQVWSALQMSKALQDSAPDRPSPVERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EHMT1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17670.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GLP/EHMT1 Recombinant Protein Antigen

  • DEL9q34
  • EC 2.1.1.-
  • EC 2.1.1.43
  • EHMT1
  • euchromatic histone-lysine N-methyltransferase 1H3-K9-HMTase 5
  • Eu-HMTase1
  • Eu-HMTase1DEL9q34
  • EUHMTASE1FP13812
  • FLJ12879
  • G9a-like protein 1
  • GLP
  • GLP1
  • H3 lysine-9 specific 5
  • KIAA1876euchromatic histone methyltransferase 1
  • KMT1D
  • KMT1DDKFZp667M072
  • Lysine N-methyltransferase 1D

Background

Euchromatic histone-lysine N-methyltransferase 1 (EHMT1) is a histone methyltransferase that catalyzes the methylation of lysine-9 of histone H3 (H3-K9). H3-K9 histone methylation is restricted to euchromatin and functions to epigenetically silence gene transcription. Loss of function mutations in EHMT1 cause the 9q34 subtelomeric deletion syndrome, a syndrome characterized by severe mental retardation, hypotonia, brachy(micro)cephaly, heart defects, and distinct facial anomalies. Alternate names for EHMT1 include histone H3-K9 methyltransferase 5, H3-K9-HMTase5, eu-HMTase, G9a-like protein 1, GLP1, lysine N-methyltransferase 1D, EUHMTASE1, KMT1D, and KIAA1876.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-86422
Species: Hu, Mu
Applications: IHC,  IHC-P
NBP1-97308
Species: Ca, Hu, Mu, Rt
Applications: DB, ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
AF1180
Species: Hu
Applications: ICC, IHC, Simple Western, WB
PP-A8620A-00
Species: Hu, Mu
Applications: DirELISA, IHC, IP, WB
NBP2-44318
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
AF3145
Species: Hu
Applications: WB
NBP1-80865
Species: Hu
Applications: IHC,  IHC-P
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
MAB2358
Species: Hu, Mu
Applications: ICC, IHC
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
NBP2-62664
Species: Hu
Applications: IHC,  IHC-P
NBP2-46349
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-1793
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, PEP-ELISA
MAB8200
Species: Hu, Mu
Applications: IHC

Publications for GLP/EHMT1 Recombinant Protein Antigen (NBP3-17670PEP) (0)

There are no publications for GLP/EHMT1 Recombinant Protein Antigen (NBP3-17670PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLP/EHMT1 Recombinant Protein Antigen (NBP3-17670PEP) (0)

There are no reviews for GLP/EHMT1 Recombinant Protein Antigen (NBP3-17670PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GLP/EHMT1 Recombinant Protein Antigen (NBP3-17670PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GLP/EHMT1 Products

Research Areas for GLP/EHMT1 Recombinant Protein Antigen (NBP3-17670PEP)

Find related products by research area.

Blogs on GLP/EHMT1

There are no specific blogs for GLP/EHMT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GLP/EHMT1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EHMT1