GLMN Antibody

Images

 
Western Blot: GLMN Antibody [NBP2-14056] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: NTERA-2 Medium
Immunohistochemistry-Paraffin: GLMN Antibody [NBP2-14056] - Staining of human kidney shows cytoplasmic positivity in cells in glomeruli and in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GLMN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LSAIGHPFPKMIFNHGRKKRTWNYLEFEEEENKQLADSMASLAYLVFVQG IHIDQLPMVLSPLYLLQFNMGHIEVFLQRTEESV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLMN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GLMN Protein (NBP2-14056PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GLMN Antibody

  • FAP
  • FAP48FAP68
  • FKBPAP
  • GLMLFK506-binding protein-associated protein
  • glomulin
  • glomulin, FKBP associated protein
  • GVM
  • GVMFKBP-associated protein
  • VMGLOMvenous malformation with glomus cells

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB100-621
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-56552
Species: Hu
Applications: WB
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB600-1032
Species: Hu, Mu, Rt, Ba
Applications: WB, ICC/IF, IHC
NBP1-84993
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-01521
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-14056
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GLMN Antibody (NBP2-14056) (0)

There are no publications for GLMN Antibody (NBP2-14056).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLMN Antibody (NBP2-14056) (0)

There are no reviews for GLMN Antibody (NBP2-14056). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLMN Antibody (NBP2-14056) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GLMN Products

Bioinformatics Tool for GLMN Antibody (NBP2-14056)

Discover related pathways, diseases and genes to GLMN Antibody (NBP2-14056). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLMN Antibody (NBP2-14056)

Discover more about diseases related to GLMN Antibody (NBP2-14056).
 

Pathways for GLMN Antibody (NBP2-14056)

View related products by pathway.

PTMs for GLMN Antibody (NBP2-14056)

Learn more about PTMs related to GLMN Antibody (NBP2-14056).
 

Research Areas for GLMN Antibody (NBP2-14056)

Find related products by research area.

Blogs on GLMN

There are no specific blogs for GLMN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLMN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLMN