Recombinant Human Gliomedin Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Gliomedin Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 131 - 240 of Human COLM partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SRRAKGPRQPSMFNGQCPGETCAIPNDDTLVGKADEKASEHHSPQAESMITSIGNPVQVLKVTETFGTWIRESANKSDDRIWVTEHFSGIMVKEFKDQPSLLNGSYTFIH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GLDN
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Gliomedin Protein

  • CLOM
  • collomin
  • COLM
  • colmedin
  • CRGL2
  • CRG-L2
  • FLJ23917
  • gliomedin
  • UNC-112

Background

GLDN - collomin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-47745
Species: Hu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2034
Species: Hu
Applications: WB, IHC
H00003611-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP2-45641
Species: Hu
Applications: WB, IHC
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-89883
Species: Hu
Applications: WB, IHC, IHC-P
AF4636
Species: Mu
Applications: WB
AF7548
Species: Hu
Applications: IHC
AF5614
Species: Hu
Applications: WB
NBP2-16396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-86665
Species: Hu
Applications: WB, IHC, IHC-P
MAB3446
Species: Hu
Applications: WB
NBP2-47405
Species: Hu
Applications: IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00342035-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Gliomedin Partial Recombinant Protein (H00342035-Q01) (0)

There are no publications for Gliomedin Partial Recombinant Protein (H00342035-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gliomedin Partial Recombinant Protein (H00342035-Q01) (0)

There are no reviews for Gliomedin Partial Recombinant Protein (H00342035-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Gliomedin Partial Recombinant Protein (H00342035-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Gliomedin Products

Bioinformatics Tool for Gliomedin Partial Recombinant Protein (H00342035-Q01)

Discover related pathways, diseases and genes to Gliomedin Partial Recombinant Protein (H00342035-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gliomedin Partial Recombinant Protein (H00342035-Q01)

Discover more about diseases related to Gliomedin Partial Recombinant Protein (H00342035-Q01).
 

Pathways for Gliomedin Partial Recombinant Protein (H00342035-Q01)

View related products by pathway.

Research Areas for Gliomedin Partial Recombinant Protein (H00342035-Q01)

Find related products by research area.

Blogs on Gliomedin

There are no specific blogs for Gliomedin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Gliomedin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GLDN