Recombinant Human GLE1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GLE1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-101 of Human GLE1L partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RMKGTEGLRLWQEEQERKVQALSEMASEQLKRFDEWKELKQHKEFQDLREVMEKSSREALGHQEKLKAEHRHRAKILNLKLREAEQQRVKQAEQERLRKEE

Protein/Peptide Type
Partial Recombinant Protein
Gene
GLE1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GLE1 Protein

  • GLE1 (yeast homolog)-like, RNA export mediator
  • GLE1 RNA export mediator homolog (yeast)
  • GLE1LGLE1 RNA export mediator-like (yeast)
  • GLE1-like protein
  • GLE1-like, RNA export mediator
  • hGLE1GLE1 RNA export mediator (yeast)
  • LCCS
  • LCCS1
  • lethal congenital contracture syndrome 1
  • nucleoporin GLE1

Background

This gene encodes a predicted 75-kDa polypeptide with high sequence and structure homology to yeast Gle1p, which is nuclear protein with a leucine-rich nuclear export sequence essential for poly(A)+RNA export. Inhibition of human GLE1L by microinjection of antibodies against GLE1L in HeLa cells resulted in inhibition of poly(A)+RNA export. Immunofluorescence studies show that GLE1L is localized at the nuclear pore complexes. This localization suggests that GLE1L may act at a terminal step in the export of mature RNA messages to the cytoplasm. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-760
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP1-88706
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1894
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-86712
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2244
Species: Hu
Applications: WB, ICC/IF, IHC-P, IP
NBP1-82986
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBL1-13885
Species: Hu
NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32367
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-02293
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB3481
Species: Hu
Applications: Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
MAB3650
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00002733-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for GLE1 Partial Recombinant Protein (H00002733-Q01) (0)

There are no publications for GLE1 Partial Recombinant Protein (H00002733-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLE1 Partial Recombinant Protein (H00002733-Q01) (0)

There are no reviews for GLE1 Partial Recombinant Protein (H00002733-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLE1 Partial Recombinant Protein (H00002733-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GLE1 Products

Bioinformatics Tool for GLE1 Partial Recombinant Protein (H00002733-Q01)

Discover related pathways, diseases and genes to GLE1 Partial Recombinant Protein (H00002733-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLE1 Partial Recombinant Protein (H00002733-Q01)

Discover more about diseases related to GLE1 Partial Recombinant Protein (H00002733-Q01).
 

Pathways for GLE1 Partial Recombinant Protein (H00002733-Q01)

View related products by pathway.

PTMs for GLE1 Partial Recombinant Protein (H00002733-Q01)

Learn more about PTMs related to GLE1 Partial Recombinant Protein (H00002733-Q01).

Blogs on GLE1

There are no specific blogs for GLE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GLE1 Antibody
NBP1-76975

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GLE1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GLE1