Recombinant Human GKAP/DLGAP1 GST (N-Term) Protein

SDS-Page: Recombinant Human GKAP/DLGAP1 Protein [H00009229-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, PA, PAGE, AP

Recombinant Human GKAP/DLGAP1 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human GKAP/DLGAP1
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MKGLSGSRSHHHGVTCDSACDSLSHHSDRKPYLLSPVEHHPADHPYYTQRNSFQAECVGPFSDPLASSTFPRRHYTSQQELKDECALVPRTLATKANRIP

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: DLGAP1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 36.74 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GKAP/DLGAP1 GST (N-Term) Protein

• DAP1
• DAP-1-ALPHA
• DAP-1DAP-1-BETA
• discs, large (Drosophila) homolog-associated protein 1
• disks large-associated protein 1
• DLGAP1
• GKAP
• GKAPMGC88156
• hGKAP
• PSD-95/SAP90 binding protein 1
• PSD-95/SAP90-binding protein 1
• SAP90/PSD-95-associated protein 1
• SAPAP1
• SAPAP1Guanylate kinase-associated protein

Background

Members of the postsynaptic density-95 (PSD-95)/SAP90 family of membraneassociated guanylate kinase (MAGUK) proteins function as multimodular scaffolds that organize protein-signaling complexes at neuronal synapses. PSD-95/SAP90 binds guanylate kinase-associated protein (GKAP), also designated GK domain-binding protein, DAP-1-alpha, DAP-1-beta, PSD-95 binding protein, PSD-95/SAP90 associated protein, or SAPAP1, through the guanylate kinase domain. SAPAP1 is expressed widely in neurons of the cortex and hippocampus and in the Purkinje and granule cells of the cerebellum. N-terminal splice variants of SAPAP1 are expressed as 95 and 130 kDa proteins. SAPAP1 is localized specifically in the PSD of glutamatergic synapses, consistent with its direct interaction with PSD-95 family proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DLGAP1