Recombinant Human GKAP/DLGAP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GKAP/DLGAP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human DLGAP1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKGLSGSRSHHHGVTCDSACDSLSHHSDRKPYLLSPVEHHPADHPYYTQRNSFQAECVGPFSDPLASSTFPRRHYTSQQELKDECALVPRTLATKANRIP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
DLGAP1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GKAP/DLGAP1 Protein

  • DAP1
  • DAP-1-ALPHA
  • DAP-1DAP-1-BETA
  • discs, large (Drosophila) homolog-associated protein 1
  • disks large-associated protein 1
  • DLGAP1
  • GKAP
  • GKAPMGC88156
  • hGKAP
  • PSD-95/SAP90 binding protein 1
  • PSD-95/SAP90-binding protein 1
  • SAP90/PSD-95-associated protein 1
  • SAPAP1
  • SAPAP1Guanylate kinase-associated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15083
Species: Hu, Rt
Applications: WB, IHC, IHC-P
AF7035
Species: Hu
Applications: IHC
NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB300-167
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-713
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91685
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-44999
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-47610
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF877
Species: Hu
Applications: WB, IHC, IP
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
H00009229-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for GKAP/DLGAP1 Partial Recombinant Protein (H00009229-Q01) (0)

There are no publications for GKAP/DLGAP1 Partial Recombinant Protein (H00009229-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GKAP/DLGAP1 Partial Recombinant Protein (H00009229-Q01) (0)

There are no reviews for GKAP/DLGAP1 Partial Recombinant Protein (H00009229-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GKAP/DLGAP1 Partial Recombinant Protein (H00009229-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GKAP/DLGAP1 Products

GKAP/DLGAP1 H00009229-Q01

Bioinformatics Tool for GKAP/DLGAP1 Partial Recombinant Protein (H00009229-Q01)

Discover related pathways, diseases and genes to GKAP/DLGAP1 Partial Recombinant Protein (H00009229-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GKAP/DLGAP1 Partial Recombinant Protein (H00009229-Q01)

Discover more about diseases related to GKAP/DLGAP1 Partial Recombinant Protein (H00009229-Q01).
 

Pathways for GKAP/DLGAP1 Partial Recombinant Protein (H00009229-Q01)

View related products by pathway.

PTMs for GKAP/DLGAP1 Partial Recombinant Protein (H00009229-Q01)

Learn more about PTMs related to GKAP/DLGAP1 Partial Recombinant Protein (H00009229-Q01).

Blogs on GKAP/DLGAP1

There are no specific blogs for GKAP/DLGAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

nNOS Antibody
NB100-858

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GKAP/DLGAP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DLGAP1
Entrez