GIMAP5 Antibody - BSA Free

Western Blot: GIMAP5 Antibody [NBP1-59485] - Titration: 0.2-1 ug/ml, Positive Control: Human Placenta.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GIMAP5 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GIMAP5(GTPase, IMAP family member 5) The peptide sequence was selected from the middle region of GIMAP5 (NP_060854). Peptide sequence CERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GIMAP5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GIMAP5 Antibody - BSA Free

• FLJ11296
• GTPase, IMAP family member 5
• hIAN5
• HIMAP3
• IAN4
• IAN4L1IROD
• IAN5
• IAN-5
• IMAP3GTPase IMAP family member 5
• immune associated nucleotide 4 like 1 (mouse)
• immune associated nucleotide 4 like 1
• immunity associated protein 3
• Immunity-associated nucleotide 4-like 1 protein
• Immunity-associated nucleotide 5 protein
• Immunity-associated protein 3
• inhibitor of radiation- and OA-induced apoptosis, Irod/Ian5

Background

GIMAP5 belongs to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GIMAP5
• Entrez:
  • 55340(Human)
• Uniprot:
  • Q96F15(Human)