GIMAP7 Antibody

Images

 
Western Blot: GIMAP7 Antibody [NBP1-81625] - Analysis in control (vector only transfected HEK293T lysate) and GIMAP7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: GIMAP7 Antibody [NBP1-81625] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: GIMAP7 Antibody [NBP1-81625] - Staining in human lymph node and skeletal muscle tissues using anti-GIMAP7 antibody. Corresponding GIMAP7 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: GIMAP7 Antibody [NBP1-81625] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: GIMAP7 Antibody [NBP1-81625] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

GIMAP7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MAESEDRSLRIVLVGKTGSGKSATANTILGEEIFDSRIAAQAVTKNCQKASREWQGRDLLVVDT
Specificity
Specificity of human GIMAP7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GIMAP7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GIMAP7 Protein (NBP1-81625PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GIMAP7 Antibody

  • GTPase, IMAP family member 7
  • hIAN7
  • IAN-7
  • IAN7GTPase IMAP family member 7
  • immune associated nucleotide
  • Immunity-associated nucleotide 7 protein
  • MGC27027

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31165
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-57487
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-6405
Species: Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-16658
Species: Hu
Applications: WB
NB100-2702
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready
MAB4077
Species: Hu
Applications: WB, IHC
NBP2-03730
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85059
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GIMAP7 Antibody (NBP1-81625) (0)

There are no publications for GIMAP7 Antibody (NBP1-81625).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GIMAP7 Antibody (NBP1-81625) (0)

There are no reviews for GIMAP7 Antibody (NBP1-81625). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GIMAP7 Antibody (NBP1-81625) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GIMAP7 Products

Bioinformatics Tool for GIMAP7 Antibody (NBP1-81625)

Discover related pathways, diseases and genes to GIMAP7 Antibody (NBP1-81625). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GIMAP7 Antibody (NBP1-81625)

Discover more about diseases related to GIMAP7 Antibody (NBP1-81625).
 

Pathways for GIMAP7 Antibody (NBP1-81625)

View related products by pathway.

Blogs on GIMAP7

There are no specific blogs for GIMAP7, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GIMAP7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GIMAP7