GFER/ALR Antibody


Western Blot: GFER/ALR Antibody [NBP1-90187] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: GFER/ALR Antibody [NBP1-90187] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & mitochondria.
Immunohistochemistry-Paraffin: GFER/ALR Antibody [NBP1-90187] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

GFER/ALR Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: QQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Specificity of human, rat GFER/ALR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GFER/ALR Protein (NBP1-90187PEP)
Read Publication using
NBP1-90187 in the following applications:

  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (85%). Human reactivity reported in scientific literature (PMID: 25012650).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GFER/ALR Antibody

  • ALR
  • ALRFAD-linked sulfhydryl oxidase ALR
  • Augmenter of liver regeneration
  • EC
  • ERV1 homolog
  • ERV1
  • ERV1hepatopoietin protein
  • erv1-like growth factor
  • GFER
  • growth factor, augmenter of liver regeneration
  • growth factor, erv1 (S. cerevisiae)-like (augmenter of liver regeneration)
  • Hepatopoietin
  • HERV1
  • HERV1hepatic regenerative stimulation substance
  • HPO
  • HPO1
  • HPO2
  • HSS
  • truncated augmenter of liver regeneration


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
Species: Hu
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P

Publications for GFER/ALR Antibody (NBP1-90187)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for GFER/ALR Antibody (NBP1-90187) (0)

There are no reviews for GFER/ALR Antibody (NBP1-90187). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GFER/ALR Antibody (NBP1-90187) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GFER/ALR Products

Bioinformatics Tool for GFER/ALR Antibody (NBP1-90187)

Discover related pathways, diseases and genes to GFER/ALR Antibody (NBP1-90187). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GFER/ALR Antibody (NBP1-90187)

Discover more about diseases related to GFER/ALR Antibody (NBP1-90187).

Pathways for GFER/ALR Antibody (NBP1-90187)

View related products by pathway.

PTMs for GFER/ALR Antibody (NBP1-90187)

Learn more about PTMs related to GFER/ALR Antibody (NBP1-90187).

Blogs on GFER/ALR

There are no specific blogs for GFER/ALR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GFER/ALR Antibody and receive a gift card or discount.


Gene Symbol GFER