Recombinant Human Gemin 4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Gemin 4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 959-1057 of Human GEMIN4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AAGPWVQGPEQDLTQEALFVYTQVFCHALHIMAMLHPEVCEPLYVLALETLTCYETLSKTNPSVSSLLQRAHEQRFLKSIAEGIGPEERRQTLLQKMSS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GEMIN4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Gemin 4 Protein

  • component of gems 4
  • DKFZp434B131
  • DKFZP434D174
  • gem (nuclear organelle) associated protein 4
  • gemin-4
  • HC56
  • HCAP1
  • HCC-associated protein 1
  • HHRF-1
  • p97DKFZp434D174

Background

GEMIN4 - gem (nuclear organelle) associated protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-13676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-46289
Species: Hu
Applications: WB, IHC
AF5758
Species: Hu
Applications: WB, IHC, ICC
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB1904
Species: Hu
Applications: WB, IHC, ICC
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
MAB8175
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-82166
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52453
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-448
Species: Hu, Mu, Ca, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00050628-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Gemin 4 Partial Recombinant Protein (H00050628-Q01) (0)

There are no publications for Gemin 4 Partial Recombinant Protein (H00050628-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gemin 4 Partial Recombinant Protein (H00050628-Q01) (0)

There are no reviews for Gemin 4 Partial Recombinant Protein (H00050628-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Gemin 4 Partial Recombinant Protein (H00050628-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Gemin 4 Products

Bioinformatics Tool for Gemin 4 Partial Recombinant Protein (H00050628-Q01)

Discover related pathways, diseases and genes to Gemin 4 Partial Recombinant Protein (H00050628-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gemin 4 Partial Recombinant Protein (H00050628-Q01)

Discover more about diseases related to Gemin 4 Partial Recombinant Protein (H00050628-Q01).
 

Pathways for Gemin 4 Partial Recombinant Protein (H00050628-Q01)

View related products by pathway.

Blogs on Gemin 4

There are no specific blogs for Gemin 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Gemin 4 Antibody
NB110-40591
eIF4G1 Antibody
NB100-268

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Gemin 4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GEMIN4