Gemin 4 Antibody

Western Blot: Gemin 4 Antibody [NBP1-52913] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Discontinued

Gemin 4 Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GEMIN4(gem (nuclear organelle) associated protein 4) The peptide sequence was selected from the N terminal of GEMIN4. Peptide sequence QALAEKVKEAERDVSLTSLAKLPSETIFVGCEFLHHLLREWGEELQAVLR. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GEMIN4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 120 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Gemin 4 Antibody

• component of gems 4
• DKFZp434B131
• DKFZP434D174
• gem (nuclear organelle) associated protein 4
• gemin-4
• HC56
• HCAP1
• HCC-associated protein 1
• HHRF-1
• p97DKFZp434D174

Background

The product of this gene is part of a large complex localized to the cytoplasm, nucleoli, and to discrete nuclear bodies called Gemini bodies (gems). The complex functions in spliceosomal snRNP assembly in the cytoplasm, and regenerates spliceosomes requi

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GEMIN4
• Uniprot:
  • Q8WUM5(Human)