GEM Recombinant Protein Antigen

Images

 
There are currently no images for GEM Protein (NBP1-81350PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GEM Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GEM.

Source: E.coli

Amino Acid Sequence: NTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMVDGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITD

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GEM
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-81350.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for GEM Recombinant Protein Antigen

  • GTP binding protein overexpressed in skeletal muscle
  • GTP-binding mitogen-induced T-cell protein
  • GTP-binding protein GEM
  • GTP-binding protein overexpressed in skeletal muscle
  • kinase-inducible Ras-like protein
  • KIRMGC26294
  • RAS-like protein KIR

Background

The protein encoded by the GEM gene belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the innerface of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction.Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-50419
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IP, WB
MAB1058
Species: Hu
Applications: Block, CyTOF-ready, Flow
MAB2014
Species: Hu
Applications: CyTOF-reported, Flow
NB100-56618
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, WB
MAB1059
Species: Hu
Applications: CyTOF-ready, Flow
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
MAB1225
Species: Hu
Applications: Block, CyTOF-reported, Flow
MAB1844
Species: Hu
Applications: CyTOF-reported, Flow
MAB8887
Species: Hu
Applications: Flow
7268-CT
Species: Hu
Applications: BA
MAB2238
Species: Hu
Applications: AgAct, CyTOF-reported, Flow
NBP1-82874
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
3015-KR
Species: Hu
Applications: BA
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-12900
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, Simple Western, WB
NBP2-27500
Species: Mu
Applications: KO, PEP-ELISA, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-81350PEP
Species: Hu
Applications: AC

Publications for GEM Protein (NBP1-81350PEP) (0)

There are no publications for GEM Protein (NBP1-81350PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GEM Protein (NBP1-81350PEP) (0)

There are no reviews for GEM Protein (NBP1-81350PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GEM Protein (NBP1-81350PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GEM Products

Bioinformatics Tool for GEM Protein (NBP1-81350PEP)

Discover related pathways, diseases and genes to GEM Protein (NBP1-81350PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GEM Protein (NBP1-81350PEP)

Discover more about diseases related to GEM Protein (NBP1-81350PEP).
 

Pathways for GEM Protein (NBP1-81350PEP)

View related products by pathway.

PTMs for GEM Protein (NBP1-81350PEP)

Learn more about PTMs related to GEM Protein (NBP1-81350PEP).
 

Research Areas for GEM Protein (NBP1-81350PEP)

Find related products by research area.

Blogs on GEM

There are no specific blogs for GEM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GEM Antibody
NBP1-58906

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GEM Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GEM