GEM Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

GEM Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GEM.
  
  

  Source: E.coli

  Amino Acid Sequence: NTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMVDGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITD

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: GEM
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This peptide is useful as a blocking peptide for NBP1-81350.
  Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.
  
  For further blocking peptide related information and a protocol, click here.
• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for GEM Recombinant Protein Antigen

• GTP binding protein overexpressed in skeletal muscle
• GTP-binding mitogen-induced T-cell protein
• GTP-binding protein GEM
• GTP-binding protein overexpressed in skeletal muscle
• kinase-inducible Ras-like protein
• KIRMGC26294
• RAS-like protein KIR

Background

The protein encoded by the GEM gene belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the innerface of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction.Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GEM