GDI1 Antibody

Images

 
Western Blot: GDI1 Antibody [NBP2-14041] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: GDI1 Antibody [NBP2-14041] - Staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GDI1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YRKFDLGQDVIDFTGHALALYRTDDYLDQPCLET
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GDI1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GDI1 Protein (NBP2-14041PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GDI1 Antibody

  • FLJ41411
  • GDI-1
  • GDIL
  • GDP dissociation inhibitor 1
  • Guanosine diphosphate dissociation inhibitor 1
  • mental retardation, X-linked 41
  • mental retardation, X-linked 48
  • MRX41
  • oligophrenin-2
  • OPHN2MRX48
  • Protein XAP-4
  • Rab GDI alpha
  • rab GDP dissociation inhibitor alpha
  • rab GDP-dissociation inhibitor, alpha
  • RABGDIARABGD1A
  • XAP4
  • XAP-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006532-M06
Species: Hu
Applications: ELISA, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBL1-15012
Species: Hu
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NLS12
Species: Hu, Po, Bt, Bv, Ca, Eq, Mk, Pm, Rb
Applications: IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-32630
Species: Hu
Applications: IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-14041
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for GDI1 Antibody (NBP2-14041) (0)

There are no publications for GDI1 Antibody (NBP2-14041).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GDI1 Antibody (NBP2-14041) (0)

There are no reviews for GDI1 Antibody (NBP2-14041). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GDI1 Antibody (NBP2-14041) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GDI1 Products

Bioinformatics Tool for GDI1 Antibody (NBP2-14041)

Discover related pathways, diseases and genes to GDI1 Antibody (NBP2-14041). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GDI1 Antibody (NBP2-14041)

Discover more about diseases related to GDI1 Antibody (NBP2-14041).
 

Pathways for GDI1 Antibody (NBP2-14041)

View related products by pathway.

PTMs for GDI1 Antibody (NBP2-14041)

Learn more about PTMs related to GDI1 Antibody (NBP2-14041).

Blogs on GDI1

There are no specific blogs for GDI1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GDI1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GDI1