GDI1 Antibody


Western Blot: GDI1 Antibody [NBP2-14041] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane more
Immunohistochemistry-Paraffin: GDI1 Antibody [NBP2-14041] - Staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

GDI1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: YRKFDLGQDVIDFTGHALALYRTDDYLDQPCLET
Specificity of human GDI1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GDI1 Protein (NBP2-14041PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GDI1 Antibody

  • FLJ41411
  • GDI-1
  • GDIL
  • GDP dissociation inhibitor 1
  • Guanosine diphosphate dissociation inhibitor 1
  • mental retardation, X-linked 41
  • mental retardation, X-linked 48
  • MRX41
  • oligophrenin-2
  • OPHN2MRX48
  • Protein XAP-4
  • Rab GDI alpha
  • rab GDP dissociation inhibitor alpha
  • rab GDP-dissociation inhibitor, alpha
  • XAP4
  • XAP-4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Po, Bt, Bv, Ca, Eq, Mk, Pm, Rb
Applications: IHC-P
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for GDI1 Antibody (NBP2-14041) (0)

There are no publications for GDI1 Antibody (NBP2-14041).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GDI1 Antibody (NBP2-14041) (0)

There are no reviews for GDI1 Antibody (NBP2-14041). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GDI1 Antibody (NBP2-14041) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for GDI1 Antibody (NBP2-14041)

Discover related pathways, diseases and genes to GDI1 Antibody (NBP2-14041). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GDI1 Antibody (NBP2-14041)

Discover more about diseases related to GDI1 Antibody (NBP2-14041).

Pathways for GDI1 Antibody (NBP2-14041)

View related products by pathway.

PTMs for GDI1 Antibody (NBP2-14041)

Learn more about PTMs related to GDI1 Antibody (NBP2-14041).

Blogs on GDI1

There are no specific blogs for GDI1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GDI1 Antibody and receive a gift card or discount.


Gene Symbol GDI1