GCN1L1 Antibody - BSA Free

Western Blot: GCN1L1 Antibody [NBP3-35306] - Western Blot analysis of lysates from wild type(WT) and GCN1L1 knockout (KO) 293T(KO) cells, using [KO Validated] GCN1L1 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GCN1L1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GCN1L1 Antibody - BSA Free (NBP3-35306) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 2462-2671 of human GCN1L1 (NP_006827.1).
  
  Sequence:
  LSAVLQQCLLADVSGIDWMVRHGRSLALSVAVNVAPGRLCAGRYSSDVQEMILSSATADRIPIAVSGVRGMGFLMRHHIETGGGQLPAKLSSLFVKCLQNPSSDIRLVAEKMIWWANKDPLPPLDPQAIKPILKALLDNTKDKNTVVRAYSDQAIVNLLKMRQGEEVFQSLSKILDVASLEVLNEVNRRSLKKLASQADSTEQVDDTILT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GCN1L1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 293 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for GCN1L1 Antibody - BSA Free

• GCN1 (general control of amino-acid synthesis 1, yeast)-like 1
• GCN1 general control of amino-acid synthesis 1-like 1 (yeast)
• GCN1
• GCN1L
• GCN1-like protein 1
• HsGCN1
• KIAA0219hsGCN1
• peroxisome proliferator activated receptor interacting complex protein
• PRIC295
• translational activator GCN1

Background

GCN1L1 (general control of amino-acid synthesis 1 like 1) is structurally similar to GCN1, a yeast factor that associates with ribosomes and participates in translational elongation. Alternative names for GCN1L1 include translational activator GCN1, GCN1-like protein 1, HsGCN1, and KIAA0219.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GCN1L1