GCN1L1 Antibody - BSA Free

Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83383] - Staining of human skeletal muscle, skin, stomach and testis using Anti-GCN1L1 antibody NBP1-83383 (A) shows similar protein distribution across tissues to independent antibody NBP1-83382 (B).

Immunocytochemistry/Immunofluorescence: GCN1L1 Antibody [NBP1-83383] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.

Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83383] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83383] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83383] - Staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83383] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GCN1L1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EALVTDAGEVTEAGKAYVPPRVLQEALCVISGVPGLKGDVTDTEQLAQEMLIISHHPSLVAVQSGLWPALLARMKIDPEAFITRHLDQIIPRMTTQSPLNQSSMNAMGSLSVLSPDRVLPQLISTITA
• Predicted Species: Mouse (94%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GCN1L1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GCN1L1 Protein (NBP1-83383PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GCN1L1 Antibody - BSA Free

• GCN1 (general control of amino-acid synthesis 1, yeast)-like 1
• GCN1 general control of amino-acid synthesis 1-like 1 (yeast)
• GCN1
• GCN1L
• GCN1-like protein 1
• HsGCN1
• KIAA0219hsGCN1
• peroxisome proliferator activated receptor interacting complex protein
• PRIC295
• translational activator GCN1

Background

GCN1L1 (general control of amino-acid synthesis 1 like 1) is structurally similar to GCN1, a yeast factor that associates with ribosomes and participates in translational elongation. Alternative names for GCN1L1 include translational activator GCN1, GCN1-like protein 1, HsGCN1, and KIAA0219.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GCN1L1 Antibody (NBP1-83383)(1)

Publication using NBP1-83383

• Oltion K, Carelli JD, Yang T et al. An E3 ligase network engages GCN1 to promote the degradation of translation factors on stalled ribosomes Cell 2023-01-19 [PMID: 36638793] (KD, WB, Human)
  
  Details:
  KD see supplemental figure S5

Bioinformatics

• Gene Symbol: GCN1L1