GCN1L1 Antibody

Images

 
Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83381] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GCN1L1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLPLLIQTVEKAASQSTQVPTITEGVAAALLLLKLSVADSQAEAKLSSFWQLIVDEKKQVFTSEKFLVMASEDALCTVLHLTERLFLDHPHRLTGNKVQQYHRALVAVLLSRTWHVRRQAQQTVRKLLSSL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GCN1L1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GCN1L1 Protein (NBP1-83381PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GCN1L1 Antibody

  • GCN1 (general control of amino-acid synthesis 1, yeast)-like 1
  • GCN1 general control of amino-acid synthesis 1-like 1 (yeast)
  • GCN1
  • GCN1L
  • GCN1-like protein 1
  • HsGCN1
  • KIAA0219hsGCN1
  • peroxisome proliferator activated receptor interacting complex protein
  • PRIC295
  • translational activator GCN1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48549
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86221
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00000468-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP1-85457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-52926
Species: Hu
Applications: WB
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01425
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3764
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
NBP1-83381
Species: Hu
Applications: IHC, IHC-P

Publications for GCN1L1 Antibody (NBP1-83381) (0)

There are no publications for GCN1L1 Antibody (NBP1-83381).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GCN1L1 Antibody (NBP1-83381) (0)

There are no reviews for GCN1L1 Antibody (NBP1-83381). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GCN1L1 Antibody (NBP1-83381) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GCN1L1 Products

Bioinformatics Tool for GCN1L1 Antibody (NBP1-83381)

Discover related pathways, diseases and genes to GCN1L1 Antibody (NBP1-83381). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

PTMs for GCN1L1 Antibody (NBP1-83381)

Learn more about PTMs related to GCN1L1 Antibody (NBP1-83381).

Blogs on GCN1L1

There are no specific blogs for GCN1L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GCN1L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GCN1L1