GCHFR Antibody (4G6)

Images

 
Immunocytochemistry/ Immunofluorescence: GCHFR Antibody (4G6) [H00002644-M01] - Analysis of monoclonal antibody to GCHFR on HeLa cell . Antibody concentration 20 ug/ml.
Sandwich ELISA: GCHFR Antibody (4G6) [H00002644-M01] - Detection limit for recombinant GST tagged GCHFR is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF
Clone
4G6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GCHFR Antibody (4G6) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
GCHFR (NP_005249.1, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE
Specificity
GCHFR - GTP cyclohydrolase I feedback regulator (4G6)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GCHFR
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GCHFR Antibody (4G6)

  • GCHFR
  • GFRP
  • GFRPP35
  • GTP cyclohydrolase I feedback regulator
  • GTP cyclohydrolase I feedback regulatory proteinGTP cyclohydrolase 1 feedback regulatory protein
  • HsT16933
  • MGC138467
  • MGC138469
  • p35

Background

GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15843
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB1230
Species: Hu, Mu, Rt
Applications: ICC, IHC, KO, Simple Western, WB
AF1916
Species: Hu
Applications: ICC, IHC, WB
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
409-ML/CF
Species: Mu
Applications: BA
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
NBP1-84022
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32956
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-79854
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP2-38780
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-34031
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
1887-ML
Species: Mu
Applications: BA
DY1857
Species: Mu
Applications: ELISA
NBP1-83193
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NB100-82245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, Simple Western, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB

Publications for GCHFR Antibody (H00002644-M01) (0)

There are no publications for GCHFR Antibody (H00002644-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GCHFR Antibody (H00002644-M01) (0)

There are no reviews for GCHFR Antibody (H00002644-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GCHFR Antibody (H00002644-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GCHFR Products

Diseases for GCHFR Antibody (H00002644-M01)

Discover more about diseases related to GCHFR Antibody (H00002644-M01).
 

Pathways for GCHFR Antibody (H00002644-M01)

View related products by pathway.

PTMs for GCHFR Antibody (H00002644-M01)

Learn more about PTMs related to GCHFR Antibody (H00002644-M01).

Blogs on GCHFR

There are no specific blogs for GCHFR, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GCHFR Antibody (4G6) and receive a gift card or discount.

Bioinformatics

Gene Symbol GCHFR
Entrez
Uniprot