Recombinant Human GCH1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP, Enzyme Activity

Order Details

Recombinant Human GCH1 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-250 of Human GCH1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
GCH1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Enzyme Activity
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
53.24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00002643-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GCH1 GST (N-Term) Protein

  • dystonia 14
  • DYT14
  • DYT5
  • DYT5a
  • DYT5EC 3.5.4.16
  • GCH
  • GCH1
  • GTP cyclohydrolase 1
  • GTP cyclohydrolase I
  • GTPCH1
  • GTP-CH-1
  • GTP-CH-I
  • guanosine 5'-triphosphate cyclohydrolase I
  • HPABH4B

Background

GCH1( AAH25415, 1 a.a. - 251 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
NB100-858
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
NBP2-03256
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
210-TA
Species: Hu
Applications: BA
NBP3-03780
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32975
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89366
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-48615
Species: Hu
Applications: IHC, IHC-P, WB
NB110-39113
Species: Hu, Mu, Rb, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
NBP1-76917
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF3564
Species: Hu, Mu, Rt
Applications: ICC, IHC, IP, WB
NBP1-88640
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-91931
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-59794
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF8038
Species: Hu, Mu, Rt
Applications: WB

Publications for GCH1 Recombinant Protein (H00002643-P01)(1)


Reviews for GCH1 Recombinant Protein (H00002643-P01) (0)

There are no reviews for GCH1 Recombinant Protein (H00002643-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GCH1 Recombinant Protein (H00002643-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GCH1 Products

Bioinformatics Tool for GCH1 Recombinant Protein (H00002643-P01)

Discover related pathways, diseases and genes to GCH1 Recombinant Protein (H00002643-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GCH1 Recombinant Protein (H00002643-P01)

Discover more about diseases related to GCH1 Recombinant Protein (H00002643-P01).
 

Pathways for GCH1 Recombinant Protein (H00002643-P01)

View related products by pathway.

PTMs for GCH1 Recombinant Protein (H00002643-P01)

Learn more about PTMs related to GCH1 Recombinant Protein (H00002643-P01).

Blogs on GCH1

There are no specific blogs for GCH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GCH1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GCH1