GBP2 Antibody - BSA Free

Western Blot: GBP2 Antibody [NBP2-48771] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Immunocytochemistry/Immunofluorescence: GBP2 Antibody [NBP2-48771] - Immunofluorescent staining of human cell line RT4 shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: GBP2 Antibody [NBP2-48771] - Staining of human urinary bladder shows distinct cytoplasmic and nuclear positivity in urothelial cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GBP2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ERLLKEGFENESKRLQKDIWDIQMRSKSLEPICNIL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GBP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GBP2 Recombinant Protein Antigen (NBP2-48771PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GBP2 Antibody - BSA Free

• GBP-2
• GTP-binding protein 2
• Guanine nucleotide-binding protein 2
• guanylate binding protein 2, interferon-inducible
• huGBP-2
• interferon-induced guanylate-binding protein 2

Background

Interferons are cytokines that have antiviral effects and inhibit tumor cell proliferation. They induce a large number of genes in their target cells, including those coding for the guanylate-binding proteins (GBPs). GBPs are characterized by their ability to specifically bind guanine nucleotides (GMP, GDP, and GTP). The protein encoded by this gene is a GTPase that converts GTP to GDP and GMP. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GBP2