Recombinant Human GBE1 Protein

Images

 
SDS-Page: GBE1 Recombinant Protein [H00002632-P01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GBE1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-702 of Human GBE1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAAPMTPAARPEDYEAALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIGENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDPEHSYEFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHAYYASFGYQITSFFAASSRYGSPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGLNMFDGTDSCYFHSGPRGTHDLWDSRLFAYSSWEVLRFLLSNIRWWLEEYRFDGFRFDGVTSMLYHHHGVGQGFSGDYSEYFGLQVDEDALTYLMLANHLVHTLCPDSITIAEDVSGMPALCSPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNRRYLEKCIAYAESHDQALVGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMGNEFGHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLNNFDRDMNRLEERYGWLAAPQAYVSEKHEGNKIIAFERAGLLFIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAEYGGHQRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNVDLPN

Protein/Peptide Type
Recombinant Protein
Gene
GBE1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GBE1 Protein

  • 1,4-alpha-glucan-branching enzyme
  • amylo-(1,4 to 1,6) transglucosidase
  • amylo-(1,4 to 1,6) transglycosylase
  • Brancher enzyme
  • EC 2.4.1.18
  • GBE
  • glucan (1,4-alpha), branching enzyme 1
  • glycogen branching enzyme
  • Glycogen-branching enzyme

Background

The protein encoded by this gene is a glycogen branching enzyme that catalyzes the transfer of alpha-1,4-linked glucosyl units from the outer end of a glycogen chain to an alpha-1,6 position on the same or a neighboring glycogen chain. Branching of the chains is essential to increase the solubility of the glycogen molecule and, consequently, in reducing the osmotic pressure within cells. Highest level of this enzyme are found in liver and muscle. Mutations in this gene are associated with glycogen storage disease IV (also known as Andersen's disease). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-42173
Species: Hu
Applications: WB, ICC/IF, ICC
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69295
Species: Hu
Applications: WB, ICC/IF, IHC
H00007957-M02
Species: Hu, Rt
Applications: WB, ELISA
NBP1-89440
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-02009
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1749
Species: Rt
Applications: WB, IHC
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00002632-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for GBE1 Recombinant Protein (H00002632-P01) (0)

There are no publications for GBE1 Recombinant Protein (H00002632-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GBE1 Recombinant Protein (H00002632-P01) (0)

There are no reviews for GBE1 Recombinant Protein (H00002632-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GBE1 Recombinant Protein (H00002632-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GBE1 Products

Bioinformatics Tool for GBE1 Recombinant Protein (H00002632-P01)

Discover related pathways, diseases and genes to GBE1 Recombinant Protein (H00002632-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GBE1 Recombinant Protein (H00002632-P01)

Discover more about diseases related to GBE1 Recombinant Protein (H00002632-P01).
 

Pathways for GBE1 Recombinant Protein (H00002632-P01)

View related products by pathway.

Blogs on GBE1

There are no specific blogs for GBE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GBE1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GBE1