GBAS Antibody - BSA Free

Immunohistochemistry-Paraffin: GBAS Antibody [NBP2-38984] - Staining in human heart muscle and liver tissues using NBP2-38984 antibody. Corresponding GBAS RNA-seq data are presented for the same tissues.

Western Blot: GBAS Antibody [NBP2-38984] - Analysis in human cell lines A-431 and MCF-7 using anti-GBAS antibody. Corresponding GBAS RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.

Immunocytochemistry/Immunofluorescence: GBAS Antibody [NBP2-38984] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: GBAS Antibody [NBP2-38984] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: GBAS Antibody [NBP2-38984] - Staining of human liver shows only very weak positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: GBAS Antibody [NBP2-38984] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: GBAS Antibody [NBP2-38984] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GBAS Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GBAS Antibody - BSA Free (NBP2-38984) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CSLLPRLRTWTSSSNRSREDSWLKSLFVRKVD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NIPSNAP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GBAS Protein (NBP2-38984PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GBAS Antibody - BSA Free

• glioblastoma amplified sequence
• Glioblastoma-amplified sequence
• NIPSNAP2NipSnap2,4-nitrophenylphosphatase domain and non-neuronal SNAP25-like 2
• protein NipSnap homolog 2

Background

Chromosomal region 7p12, which contains GBAS, is amplified in approximately 40% of glioblastomas, the most common andmalignant form of central nervous system tumor.The predicted 286-amino acid protein contains a signal peptide, atransmembrane domain, and 2 tyrosine phosphorylation sites. The GBAS transcript is expressed most abundantly in heartand skeletal muscle. GBAS protein might be involved in vesicular transport. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NIPSNAP2
• Uniprot:
  • O75323(Human)