CHCHD1 Antibody

Images

 
Western Blot: CHCHD1 Antibody [NBP1-88532] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: CHCHD1 Antibody [NBP1-88532] - Staining of human cell line U-251 MG shows localization to nucleoplasm, nucleoli fibrillar center & mitochondria.
Immunohistochemistry-Paraffin: CHCHD1 Antibody [NBP1-88532] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CHCHD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHCHD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CHCHD1 Protein (NBP1-88532PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CHCHD1 Antibody

  • C10orf34
  • C2360
  • chromosome 10 open reading frame 34
  • coiled-coil-helix-coiled-coil-helix domain containing 1
  • coiled-coil-helix-coiled-coil-helix domain-containing protein 1
  • FLJ25854
  • Nuclear protein C2360

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-54746
Species: Hu
Applications: ICC/IF, IHC-P
NBP2-45730
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
NBP1-76888
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-88532
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CHCHD1 Antibody (NBP1-88532) (0)

There are no publications for CHCHD1 Antibody (NBP1-88532).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHCHD1 Antibody (NBP1-88532) (0)

There are no reviews for CHCHD1 Antibody (NBP1-88532). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CHCHD1 Antibody (NBP1-88532) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHCHD1 Products

Bioinformatics Tool for CHCHD1 Antibody (NBP1-88532)

Discover related pathways, diseases and genes to CHCHD1 Antibody (NBP1-88532). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHCHD1 Antibody (NBP1-88532)

Discover more about diseases related to CHCHD1 Antibody (NBP1-88532).
 

Pathways for CHCHD1 Antibody (NBP1-88532)

View related products by pathway.

PTMs for CHCHD1 Antibody (NBP1-88532)

Learn more about PTMs related to CHCHD1 Antibody (NBP1-88532).

Blogs on CHCHD1

There are no specific blogs for CHCHD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHCHD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHCHD1