CHCHD10 Antibody

Images

 
Western Blot: CHCHD10 Antibody [NBP1-91169] - Analysis in human cell lines PC-3 and U-251MG using Anti-CHCHD10 antibody. Corresponding CHCHD10 RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunocytochemistry/ Immunofluorescence: CHCHD10 Antibody [NBP1-91169] - Staining of human cell line A-431 shows positivity in mitochondria.
Immunohistochemistry-Paraffin: CHCHD10 Antibody [NBP1-91169] - Staining of human heart muscle shows granular cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
       

Orthogonal Strategies

 

Order Details

CHCHD10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GLMAQMATTAAGVAVGSAVGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHCHD10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CHCHD10 Protein (NBP1-91169PEP)
Publications
Read Publication using
NBP1-91169 in the following applications:

  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (89%). Human reactivity reported in scientific literature (PMID: 24934289).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CHCHD10 Antibody

  • C22orf16
  • coiled-coil-helix-coiled-coil-helix domain containing 10
  • mitochondrial
  • N27C7-4
  • protein N27C7-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45730
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-45490
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31333
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-91169
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CHCHD10 Antibody (NBP1-91169)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CHCHD10 Antibody (NBP1-91169) (0)

There are no reviews for CHCHD10 Antibody (NBP1-91169). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CHCHD10 Antibody (NBP1-91169) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHCHD10 Products

CHCHD10 NBP1-91169

Bioinformatics Tool for CHCHD10 Antibody (NBP1-91169)

Discover related pathways, diseases and genes to CHCHD10 Antibody (NBP1-91169). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHCHD10 Antibody (NBP1-91169)

Discover more about diseases related to CHCHD10 Antibody (NBP1-91169).
 

Pathways for CHCHD10 Antibody (NBP1-91169)

View related products by pathway.

PTMs for CHCHD10 Antibody (NBP1-91169)

Learn more about PTMs related to CHCHD10 Antibody (NBP1-91169).

Blogs on CHCHD10

There are no specific blogs for CHCHD10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHCHD10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHCHD10