GATM Antibody - BSA Free

Western Blot: GATM Antibody [NBP1-54764] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml

Western Blot: GATM Antibody [NBP1-54764] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml

Western Blot: GATM Antibody [NBP1-54764] - Sample Type: Human Fetal Heart Antibody Dilution: 1.0 ug/ml

Western Blot: GATM Antibody [NBP1-54764] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml

Western Blot: GATM Antibody [NBP1-54764] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: 721_B cell lysate GATM is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GATM Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GATM(glycine amidinotransferase (L-arginine:glycine amidinotransferase)) The peptide sequence was selected from the middle region of GATM. Peptide sequence PCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPN The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GATM
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 44 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GATM Antibody - BSA Free

• AGATtransamidinase
• AT
• EC 2.1.4
• EC 2.1.4.1
• glycine amidinotransferase (L-arginine:glycine amidinotransferase)
• glycine amidinotransferase, mitochondrial
• L-arginine:glycine amidinotransferase
• Transamidinase

Background

GATM is a mitochondrial enzyme that belongs to the amidinotransferase family. This enzyme is involved in creatine biosynthesis, whereby it catalyzes the transfer of a guanido group from L-arginine to glycine, resulting in guanidinoacetic acid, the immediate precursor of creatine. Mutations in this gene cause arginine:glycine amidinotransferase deficiency, an inborn error of creatine synthesis characterized by mental retardation, language impairment, and behavioral disorders.This gene encodes a mitochondrial enzyme that belongs to the amidinotransferase family. This enzyme is involved in creatine biosynthesis, whereby it catalyzes the transfer of a guanido group from L-arginine to glycine, resulting in guanidinoacetic acid, the immediate precursor of creatine. Mutations in this gene cause arginine:glycine amidinotransferase deficiency, an inborn error of creatine synthesis characterized by mental retardation, language impairment, and behavioral disorders. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GATM
• Uniprot:
  • P50440(Human)