We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

GATA-1 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related GATA-1 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-84792PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GATA-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GATA1.

Source: E. coli

Amino Acid Sequence: PLTMRKDGIQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEVASGLTLGPPGTAHLYQGLGPVVLSGPVSHLMPFPGPLLGSPTGSFPTGPMPPTTSTTVVAPL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GATA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84792.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GATA-1 Recombinant Protein Antigen

  • Eryf1
  • ERYF1GATA-binding protein 1 (globin transcription factor 1)
  • GATA binding protein 1 (globin transcription factor 1)
  • GATA1
  • GATA-1
  • GATA-1erythroid transcription factor
  • GATA-binding factor 1
  • GF-1
  • GF1globin transcription factor 1
  • NF-E1 DNA-binding protein
  • NFE1erythroid transcription factor 1
  • transcription factor GATA1
  • XLTT

Background

GATA1 (Globin transcription factor 1) is a Cys2/Cys2 zinc finger DNA binding protein that is expressed primarily in erythroid, megakaryocytic, mast cells and eosinophilic cells. It belongs to the GATA family of transcription factors. GATA1 is a transcriptional activator which probably serves as a general switch factor for erythroid development. It binds to DNA sites with the consensus sequence [AT]GATA[AG] within regulatory regions of globin genes and of other genes expressed in erythroid cells. The protein also plays an important role in erythroid development by regulating the switch of fetal hemoglobin to adult hemoglobin. Mutations in this gene have been associated with X-linked dyserythropoietic anemia and thrombocytopenia. Acquired somatic mutations in GATA1 occur in virtually all children with Down's Syndrome, congenital transient myeloproliferative syndrome (TMD) and acute megakaryocytic leukemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82580
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P, Simple Western, WB
NBP1-87991
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-01488
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF2046
Species: Hu, Mu
Applications: ICC, IHC, Simple Western, WB
AF2046
Species: Hu, Mu
Applications: ICC, IHC, Simple Western, WB
MEP00B
Species: Mu
Applications: ELISA
NBP2-47572
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-14081
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-37380
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
NBP2-48693
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-47940
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC,  IHC-P, Simple Western, WB
NBP2-27163
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
DPSG10
Species: Hu
Applications: ELISA
3047-CC
Species: Hu
Applications: BA
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-18715
Species: Hu
Applications: ELISA, S-ELISA
203-IL
Species: Hu
Applications: BA
DTM100
Species: Hu
Applications: ELISA
NB600-1071
Species: Hu(-), Mu
Applications: COMET, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, mIF, WB

Publications for GATA-1 Protein (NBP1-84792PEP) (0)

There are no publications for GATA-1 Protein (NBP1-84792PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GATA-1 Protein (NBP1-84792PEP) (0)

There are no reviews for GATA-1 Protein (NBP1-84792PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GATA-1 Protein (NBP1-84792PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GATA-1 Products

Research Areas for GATA-1 Protein (NBP1-84792PEP)

Find related products by research area.

Blogs on GATA-1

There are no specific blogs for GATA-1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GATA-1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GATA1