GATA-1 Recombinant Protein Antigen

Images

 
There are currently no images for GATA-1 Protein (NBP1-84792PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GATA-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GATA1.

Source: E.coli

Amino Acid Sequence: PLTMRKDGIQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEVASGLTLGPPGTAHLYQGLGPVVLSGPVSHLMPFPGPLLGSPTGSFPTGPMPPTTSTTVVAPL

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GATA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-84792.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for GATA-1 Recombinant Protein Antigen

  • Eryf1
  • ERYF1GATA-binding protein 1 (globin transcription factor 1)
  • GATA binding protein 1 (globin transcription factor 1)
  • GATA1
  • GATA-1
  • GATA-1erythroid transcription factor
  • GATA-binding factor 1
  • GF-1
  • GF1globin transcription factor 1
  • NF-E1 DNA-binding protein
  • NFE1erythroid transcription factor 1
  • transcription factor GATA1
  • XLTT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-87992
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2046
Species: Hu
Applications: WB, Simple Western, ICC
AF2046
Species: Hu
Applications: WB, Simple Western, ICC
NB100-68241
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-14081
Species: Hu
Applications: IHC, IHC-P
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-48693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-32964
Species: Hu
Applications: Flow, ICC/IF, IHC-Fr
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for GATA-1 Protein (NBP1-84792PEP) (0)

There are no publications for GATA-1 Protein (NBP1-84792PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GATA-1 Protein (NBP1-84792PEP) (0)

There are no reviews for GATA-1 Protein (NBP1-84792PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for GATA-1 Protein (NBP1-84792PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GATA-1 Products

Bioinformatics Tool for GATA-1 Protein (NBP1-84792PEP)

Discover related pathways, diseases and genes to GATA-1 Protein (NBP1-84792PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GATA-1 Protein (NBP1-84792PEP)

Discover more about diseases related to GATA-1 Protein (NBP1-84792PEP).
 

Pathways for GATA-1 Protein (NBP1-84792PEP)

View related products by pathway.

PTMs for GATA-1 Protein (NBP1-84792PEP)

Learn more about PTMs related to GATA-1 Protein (NBP1-84792PEP).
 

Research Areas for GATA-1 Protein (NBP1-84792PEP)

Find related products by research area.

Blogs on GATA-1

There are no specific blogs for GATA-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-3 [Unconjugated]
203-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GATA-1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GATA1
Entrez