GARNL1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GARNL1 Antibody [NBP1-87982] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & mitochondria.
Immunohistochemistry-Paraffin: GARNL1 Antibody [NBP1-87982] - Staining of human cerebellum shows cytoplasmic positivity in Purkinje cells, cells in molecular layer and granular layer.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GARNL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LVSCIQIRSEENMPGGGLSAGLASANSNVRIIVRDLSGKYSWDSAILYGPPPVSGLSEPTSFMLSLSHQEKPEEPPTSNECLEDITVKDGLSLQFKRFRETVPTWDTIRDEEDVLDELLQYLGVTSPECLQRTGISLNIPAPQPVCISE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RALGAPA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GARNL1 Protein (NBP1-87982PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GARNL1 Antibody

  • DKFZp566D133
  • DKFZp667F074
  • GAP-related interacting protein to E12
  • GARNL1p240
  • GRIPEGAP-related-interacting partner to E12
  • GTPase activating RANGAP domain-like 1
  • GTPase activating Rap/RanGAP domain-like 1
  • KIAA0884GTPase-activating Rap/Ran-GAP domain-like 1
  • Ral GTPase activating protein, alpha subunit 1 (catalytic)
  • ral GTPase-activating protein alpha subunit 1
  • ral GTPase-activating protein subunit alpha-1
  • RalGAPalpha1
  • Tuberin-like protein 1
  • TULIP1Tulip1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1834
Species: Hu
Applications: WB, ICC/IF, Flow-IC
H00009527-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-89232
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16197
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13440
Species: Hu
Applications: WB, IHC, IHC-P
H00009446-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF6116
Species: Hu
Applications: WB, ICC
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01345
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15412
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77285
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-80789
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GARNL1 Antibody (NBP1-87982) (0)

There are no publications for GARNL1 Antibody (NBP1-87982).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GARNL1 Antibody (NBP1-87982) (0)

There are no reviews for GARNL1 Antibody (NBP1-87982). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GARNL1 Antibody (NBP1-87982) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GARNL1 Products

GARNL1 NBP1-87982

Bioinformatics Tool for GARNL1 Antibody (NBP1-87982)

Discover related pathways, diseases and genes to GARNL1 Antibody (NBP1-87982). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GARNL1 Antibody (NBP1-87982)

Discover more about diseases related to GARNL1 Antibody (NBP1-87982).
 

Pathways for GARNL1 Antibody (NBP1-87982)

View related products by pathway.

Blogs on GARNL1

There are no specific blogs for GARNL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GARNL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RALGAPA1