gamma Tubulin Antibody (5R3N3)

Western Blot: gamma Tubulin Antibody (5R3N3) [NBP3-16852] - Western blot analysis of extracts of various cell lines, using gamma Tubulin Rabbit mAb (NBP3-16852) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Immunohistochemistry-Paraffin: gamma Tubulin Antibody (5R3N3) [NBP3-16852] - Immunohistochemistry of paraffin-embedded mouse testis using gamma Tubulin Rabbit mAb (NBP3-16852) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: gamma Tubulin Antibody (5R3N3) [NBP3-16852] - Immunohistochemistry of paraffin-embedded rat testis using gamma Tubulin Rabbit mAb (NBP3-16852) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: gamma Tubulin Antibody (5R3N3) [NBP3-16852] - Immunohistochemistry of paraffin-embedded human thyroid cancer using gamma Tubulin Rabbit mAb (NBP3-16852) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Western Blot: gamma Tubulin Antibody (5R3N3) [NBP3-16852] - Western Blot of the lysate of RM1 cells. Image from verified customer review.

Immunocytochemistry/Immunofluorescence: gamma Tubulin Antibody (5R3N3) [NBP3-16852] - Confocal imaging of NIH-3T3 cells using gamma -Tubulin Rabbit mAb (dilution 1:100) (Red). The cells were counterstained with Alpha-tubulin (ubiquitous) chain Rabbit mAb (dilution 1:100) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

Western Blot: Rabbit gamma Tubulin mAb (5R3N3) [NBP3-16852] - Western blot of the lysate of PC-3 cells. Image from a verified customer review.

Immunocytochemistry/ Immunofluorescence: gamma Tubulin Antibody (5R3N3) [NBP3-16852] - Confocal imaging of NIH-3T3 cells using gamma Tubulin Rabbit mAb . The cells were counterstained with Alpha-tubulin (ubiquitous) chain Rabbit mAb (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

Immunocytochemistry/ Immunofluorescence: gamma Tubulin Antibody (5R3N3) [NBP3-16852] - Confocal imaging of U-2OS cells using gamma Tubulin Rabbit mAb (Green). The cells were counterstained with Alpha-tubulin (ubiquitous) chain Rabbit mAb . DAPI was used for nuclear staining (blue). Objective: 60x.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 5R3N3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

gamma Tubulin Antibody (5R3N3) Summary

• Description: Novus Biologicals Rabbit gamma Tubulin Antibody (5R3N3) (NBP3-16852) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 231-451 of human gamma Tubulin (P23258). LVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQ
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TUBG1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:100 - 1:1000
  • Immunohistochemistry 1:200 - 1:2000
  • Immunohistochemistry-Paraffin 1:200 - 1:2000
  • Western Blot 1:1000 - 1:6000
• Theoretical MW: 51 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for gamma Tubulin Antibody (5R3N3)

• gamma Tubulin
• Gamma-1-tubulin
• Gamma-tubulin complex component 1
• GCP-1
• TUBG
• TUBG1
• TUBGCP1
• tubulin gamma-1 chain
• tubulin, gamma 1
• tubulin, gamma polypeptide

Background

The gamma-tubulin (TUBG1; relative molecular weight about 48 kDa) is a minor member of tubulin family (less that 0.01% of tubulin dimer). The g-tubulin ring structures, however, serve to provide structural primer for initiation of microtubular nucleation and growth, thereby being crutial for microtubule-based cellular processes, above all for mitotic spindle formation. In animal cells, a center of microtubule organization is the centrosome composed of a pair of cylindrical centrioles surrounded by fibrous pericentriolar material containing g-tubulin. Formation of the mitotic spindle is preceded by duplication of centrosome during S phase. Before mitosis, both centrosomes increase their microtubule nucleation capacity and form two microtuble asters that are pushed apart from each other by the forces of motor proteins associated at the microtubule surface.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Reviews for gamma Tubulin Antibody (NBP3-16852) (2)

Average Rating: 5

(Based on 2 reviews)

We have 2 reviews tested in 2 species: Human, Mouse.

reviewed by: Armen Petrosyan WB Human 11/19/2024

Summary

• Application: Western Blot
• Sample Tested: PC-3 human prostate cancer cell line
• Species: Human
• Lot: 4000001684

reviewed by: Armen Petrosyan WB Mouse 06/27/2023

Summary

• Application: Western Blot
• Sample Tested: Murine prostate cancer cell line RM1
• Species: Mouse
• Lot: 4000001684

Bioinformatics

• Gene Symbol: TUBG1