GADD45 alpha Antibody - Azide and BSA Free

Western Blot: GADD45 alpha Antibody [H00001647-B01P] - Analysis of GADD45A expression in transfected 293T cell line by GADD45A polyclonal antibody. Lane 1: GADD45A transfected lysate(18.30 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GADD45 alpha Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: GADD45A (AAH11757.1, 1 a.a. - 165 a.a.) full-length human protein. MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
• Specificity: Reacts with growth arrest and DNA-damage-inducible, alpha.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: GADD45A
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GADD45 alpha Antibody - Azide and BSA Free

• DDIT-1
• DDIT1growth arrest and DNA damage-inducible protein GADD45 alpha
• DNA damage-inducible transcript 1 protein
• DNA damage-inducible transcript-1
• GADD45 alpha
• GADD45a
• GADD45DNA-damage-inducible transcript 1
• growth arrest and DNA-damage-inducible 45 alpha
• growth arrest and DNA-damage-inducible, alpha

Background

This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GADD45A
• Entrez:
  • 1647(Human)
• Uniprot:
  • AAH11757.1(Human)