GABA-A R gamma 1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: NKASMTPGLHPGSTLIPMNNISVPQEDDYGYQCLEGKDC |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GABRG1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for GABA-A R gamma 1 Antibody - BSA Free
Background
GABA A Receptor gamma 1 is encoded by this gene belongs to the ligand-gated ionic channel family. It is an integral membrane protein and plays an important role in inhibiting neurotransmission by binding to the benzodiazepine receptor and opening an integral chloride channel. This gene is clustered with three other family members on chromosome 4. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, MiAr, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, KD, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: Bind
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, KO, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, KD, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ICC/IF
Publications for GABA-A R gamma 1 Antibody (NBP3-17492) (0)
There are no publications for GABA-A R gamma 1 Antibody (NBP3-17492).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GABA-A R gamma 1 Antibody (NBP3-17492) (0)
There are no reviews for GABA-A R gamma 1 Antibody (NBP3-17492).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GABA-A R gamma 1 Antibody (NBP3-17492) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GABA-A R gamma 1 Products
Research Areas for GABA-A R gamma 1 Antibody (NBP3-17492)
Find related products by research area.
|
Blogs on GABA-A R gamma 1