G6b/C6orf25 Antibody


Western Blot: C6orf25 Antibody [NBP1-69388] - This Anti-C6orf25 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

G6b/C6orf25 Antibody Summary

Synthetic peptides corresponding to C6ORF25 The peptide sequence was selected from the N terminal of C6ORF25. Peptide sequence AVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFP.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against C6orf25 and was validated on Western blot.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for G6b/C6orf25 Antibody

  • C6orf25
  • chromosome 6 open reading frame 25
  • G6b
  • immunoglobulin receptor
  • MGC142279
  • MGC142281
  • NG31
  • protein G6b


The exact function of C6orf25 remains unknown.This gene is a member of the immunoglobulin (Ig) superfamily and is located in the major histocompatibility complex (MHC) class III region. The protein encoded by this gene is a glycosylated, plasma membrane-bound cell surface receptor, but soluble isoforms encoded by some transcript variants have been found in the endoplasmic reticulum and Golgi before being secreted. Multiple transcript variants encoding different isoforms have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt, Hu(-)
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu
Species: Mu
Applications: Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, Flow, AdBlk, CyTOF-ready, ICC
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Block, ICC
Species: Mu
Applications: B/N, Flow, IHC-Fr, IP
Species: Hu
Applications: WB

Publications for G6b/C6orf25 Antibody (NBP1-69388) (0)

There are no publications for G6b/C6orf25 Antibody (NBP1-69388).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for G6b/C6orf25 Antibody (NBP1-69388) (0)

There are no reviews for G6b/C6orf25 Antibody (NBP1-69388). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for G6b/C6orf25 Antibody (NBP1-69388) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional G6b/C6orf25 Products

Bioinformatics Tool for G6b/C6orf25 Antibody (NBP1-69388)

Discover related pathways, diseases and genes to G6b/C6orf25 Antibody (NBP1-69388). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for G6b/C6orf25 Antibody (NBP1-69388)

Discover more about diseases related to G6b/C6orf25 Antibody (NBP1-69388).

Pathways for G6b/C6orf25 Antibody (NBP1-69388)

View related products by pathway.

PTMs for G6b/C6orf25 Antibody (NBP1-69388)

Learn more about PTMs related to G6b/C6orf25 Antibody (NBP1-69388).

Blogs on G6b/C6orf25

There are no specific blogs for G6b/C6orf25, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our G6b/C6orf25 Antibody and receive a gift card or discount.


Gene Symbol C6ORF25