G Protein alpha z Antibody - Azide and BSA Free

Western Blot: G Protein alpha z Antibody [NBP3-02979] - Analysis of extracts of various cell lines, using G Protein alpha z antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection:Basic ECL Kit

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

G Protein alpha z Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit G Protein alpha z Antibody - Azide and BSA Free (NBP3-02979) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human G Protein alpha z (NP_002064.1). LFDSICNNNWFINTSLILFLNKKDLLAEKIRRIPLTICFPEYKGQNTYEEAAVYIQRQFEDLNRNKETKEIYSHFTCATDTSNIQFVFDAVTDVIIQNNLK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GNAZ
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 40 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for G Protein alpha z Antibody - Azide and BSA Free

• G(x) alpha chain
• guanine nucleotide binding protein (G protein), alpha z polypeptide
• guanine nucleotide-binding protein G(z) subunit alpha
• gz-alpha
• transducin alpha

Background

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G proteins are composed of 3 units; alpha, beta and gamma. The alpha chain contains the guanine nucleotide binding site. G protein z alpha, encoded by the GNAZ gene, is enriched in neural tissue and differs in sequence from other G alpha subunits. Alpha Subunits are encoded in 15 genes and several transcripts are alternatively spliced. Receptors may discriminate between splice variants; whether splice variants are functionally different in regulating effectors is not known. All alpha subunits appear to be palmitoylated near the N-terminus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: GNAZ