G protein alpha 16 Antibody - Azide and BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 112-374 of human G protein alpha 16 (NP_002059.3). HASLVMSQDPYKVTTFEKRYAAAMQWLWRDAGIRACYERRREFHLLDSAVYYLSHLERITEEGYVPTAQDVLRSRMPTTGINEYCFSVQKTNLRIVDVGGQKSERKKWIHCFENVIALIYLASLSEYDQCLEENNQENRMKESLALFGTILELPWFKSTSVILFLNKTDILEEKIPTSHLATYFPSFQGPKQDAEAAKRFILDMYTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQNIRKVFKDVRDSVLARYLDEINLL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GNA15 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:2000
|
| Theoretical MW |
43 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for G protein alpha 16 Antibody - Azide and BSA Free
Background
G protein alpha 16 or GNA15, also known as Guanine nucleotide-binding protein subunit alpha-15, is a 374 amino acid that is 44 kDa, composed of 3 units; alpha, beta and gamma; expressed in hematopoietic cells; participates as modulator or transducer in various transmembrane signaling systems. Disease research is currently being studied with relation to this protein and fainting, pertussis, chagas disease, trypanosomiasis, epididymitis, thrombosis, neuronitis, cholera, pseudohypoparathyroidism, neuroblastoma, fibrous dysplasia, and McCune Albright syndrome. This protein has shown interactions with OPRD1, CHRM2, ADRB2, OPRK1, LTB4R AND and150 other proteins in approx. 60 pathways such as development activation of ERK by Alpha-1 adrenergic receptors, G-protein signaling G-Protein beta/gamma signaling cascades, development A1 receptor signaling, immune response ICOS pathway in T-helper cell, molecular mechanisms of cancer, intracellular calcium signaling, visual cycle in retinal rods, CDK5 pathway, and platelet aggregation inhibitor pathway, pharmacodynamics.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, Neut
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: B/N, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vivo
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Species: Rt
Applications: IHC, WB
Species: Hu
Applications: IP (-), WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC
Species: Hu, Mu
Applications: WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for G protein alpha 16 Antibody (NBP3-03249) (0)
There are no publications for G protein alpha 16 Antibody (NBP3-03249).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for G protein alpha 16 Antibody (NBP3-03249) (0)
There are no reviews for G protein alpha 16 Antibody (NBP3-03249).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for G protein alpha 16 Antibody (NBP3-03249) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional G protein alpha 16 Products
Research Areas for G protein alpha 16 Antibody (NBP3-03249)
Find related products by research area.
|
Blogs on G protein alpha 16