G protein alpha-13 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: G protein alpha-13 Antibody [NBP1-89810] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to cytosol.

Immunohistochemistry-Paraffin: G protein alpha-13 Antibody [NBP1-89810] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

G protein alpha-13 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGDKMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGES
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GNA13
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  G protein alpha-13 Protein (NBP1-89810PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for G protein alpha-13 Antibody - BSA Free

• G alpha-13
• G13
• G-protein subunit alpha-13
• guanine nucleotide binding protein (G protein), alpha 13
• guanine nucleotide-binding protein subunit alpha-13
• MGC46138

Background

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for G protein alpha-13 Antibody (NBP1-89810). (Showing 1 - 1 of 1 FAQ).

1. Could you explain why your G-alpha 13 antibody detects a band at 56kDa while many of the other commercially available antibodies show a band at 44kDa?
   • The migration of the protein depends on the experimental blot conditions, on the pretreatment of the tested protein samples, as well as on the choice of tested lysates. According to UniProt, the GNA13 protein has several post translational modifications, such as a phosphorylation on Thr-203 and a palmitoylation. Since this protein is said to be a "lipidprotein, a palmitate and a phosphoprotein", I do not think it is surprising that the band may appear larger than expected molecular weight.The link can be found here UniProt Q14344 (https://www.uniprot.org/uniprotkb/Q14344/entry).

Bioinformatics

• Gene Symbol: GNA13