FZR1/CDH1 Antibody - BSA Free

Western Blot: FZR1/CDH1 Antibody [NBP3-38164] - Western blot analysis of lysates from 293T cells, using FZR1/CDH1 Rabbit pAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 180s.

Immunocytochemistry/ Immunofluorescence: FZR1/CDH1 Antibody [NBP3-38164] - Immunofluorescence analysis of HeLa cells using FZR1/CDH1 Rabbit pAb. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FZR1/CDH1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FZR1/CDH1 Antibody - BSA Free (NBP3-38164) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 224-493 of human FZR1/CDH1 (NP_057347.2).
  
  Sequence:
  DLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKESVSVLNLFTRIR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FZR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:100 - 1:500
• Theoretical MW: 55 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for FZR1/CDH1 Antibody - BSA Free

• CDC20C
• CDH1
• Cdh1/Hct1 homolog
• CDH1CDC20-like 1b
• fizzy/cell division cycle 20 related 1 (Drosophila)
• Fzr
• FZR2
• FZRCDC20-like protein 1
• hCDH1
• HCDHFYR
• KIAA1242fizzy-related protein homolog

Background

FZR1( AAH13413, 1 a.a. - 494 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FZR1