![Immunocytochemistry/Immunofluorescence: FZR1/CDH1 Antibody [NBP1-91774] - Staining of human cell line A-431 shows localization to nucleoplasm & nuclear membrane. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/FZR1-CDH1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91774-img0004.jpg "Immunocytochemistry/Immunofluorescence: FZR1/CDH1 Antibody [NBP1-91774] - Staining of human cell line A-431 shows localization to nucleoplasm & nuclear membrane. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit FZR1/CDH1 Antibody - BSA Free (NBP1-91774) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-FZR1/CDH1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLA |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FZR1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
| Publication using NBP1-91774 | Applications | Species |
|---|---|---|
| Giraldez S, Galindo-Moreno M, Limon-Mortes MC et al. G1/S phase progression is regulated by PLK1 degradation through the CDK1/BTrCP axis. FASEB J. 2017-03-30 [PMID: 28360195] |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Human | 01/30/2018 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for FZR1/CDH1 Antibody (NBP1-91774)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FZR1 |
![Immunohistochemistry-Paraffin: FZR1/CDH1 Antibody [NBP1-91774] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.](http://images.novusbio.com/fullsize/FZR1-CDH1-Antibody-Immunohistochemistry-Paraffin-NBP1-91774-img0002.jpg "Immunohistochemistry-Paraffin: FZR1/CDH1 Antibody [NBP1-91774] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.")
![Immunohistochemistry Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Immunohistochemistry_11792.jpg)
![Western Blot Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Western_Blot_9526.jpg)
![Simple Western Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Simple_Western_20094.jpg)
![Immunohistochemistry Cadherin-13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cadherin13_AF3264_Immunohistochemistry_15873.jpg)
![Immunocytochemistry Cadherin-13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cadherin-13_AF3264_Immunocytochemistry_6491.jpg)
![Simple Western Cadherin-13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cadherin13_AF3264_Simple_Western_17005.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
