FZR1/CDH1 Antibody - BSA Free

Western Blot: FZR1/CDH1 Antibody [NBP1-56976] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Western Blot: FZR1/CDH1 Antibody [NBP1-56976] - FZR1/CDH1 Antibody 721_B cell lysate, concentration 0.2-1 ug/ml.

Western Blot: FZR1/CDH1 Antibody [NBP1-56976] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Western Blot: FZR1/CDH1 Antibody [NBP1-56976] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Western Blot: FZR1/CDH1 Antibody [NBP1-56976] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

FZR1/CDH1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to FZR1/CDH1 (fizzy/cell division cycle 20 related 1 (Drosophila)) The peptide sequence was selected from the N terminal of FZR1/CDH1. Peptide sequence SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FZR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FZR1/CDH1 Antibody - BSA Free

• CDC20C
• CDH1
• Cdh1/Hct1 homolog
• CDH1CDC20-like 1b
• fizzy/cell division cycle 20 related 1 (Drosophila)
• Fzr
• FZR2
• FZRCDC20-like protein 1
• hCDH1
• HCDHFYR
• KIAA1242fizzy-related protein homolog

Background

FZR1/CDH1 is a key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. FZR1/CDH1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1/CDH1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FZR1
• Uniprot:
  • Q9UM11(Human)