Recombinant Human Fyn Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Fyn Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-90 of Human Fyn

Source: Wheat Germ

Amino Acid Sequence: MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGGTGVTLFVAL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FYN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
35.64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Fyn Protein

  • EC 2.7.10
  • EC 2.7.10.2
  • FYN oncogene related to SRC, FGR, YES
  • Fyn
  • MGC45350
  • OKT3-induced calcium influx regulator
  • p59-Fyn
  • protein-tyrosine kinase fyn
  • Proto-oncogene c-Fyn
  • Proto-oncogene Syn
  • proto-oncogene tyrosine-protein kinase fyn
  • SLK
  • SLKc-syn protooncogene
  • src/yes-related novel
  • Src-like kinase
  • SYN
  • tyrosine kinase p59fyn(T)
  • tyrosine-protein kinase Fyn

Background

FYN - FYN oncogene related to SRC, FGR, YES

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-85804
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3206
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-85951
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB32051
Species: Hu, Mu, Rt
Applications: WB, IHC
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC
H00002534-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Fyn Partial Recombinant Protein (H00002534-Q01) (0)

There are no publications for Fyn Partial Recombinant Protein (H00002534-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fyn Partial Recombinant Protein (H00002534-Q01) (0)

There are no reviews for Fyn Partial Recombinant Protein (H00002534-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fyn Partial Recombinant Protein (H00002534-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Fyn Products

Bioinformatics Tool for Fyn Partial Recombinant Protein (H00002534-Q01)

Discover related pathways, diseases and genes to Fyn Partial Recombinant Protein (H00002534-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fyn Partial Recombinant Protein (H00002534-Q01)

Discover more about diseases related to Fyn Partial Recombinant Protein (H00002534-Q01).
 

Pathways for Fyn Partial Recombinant Protein (H00002534-Q01)

View related products by pathway.

PTMs for Fyn Partial Recombinant Protein (H00002534-Q01)

Learn more about PTMs related to Fyn Partial Recombinant Protein (H00002534-Q01).
 

Research Areas for Fyn Partial Recombinant Protein (H00002534-Q01)

Find related products by research area.

Blogs on Fyn

There are no specific blogs for Fyn, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Fyn Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FYN
Entrez