FXYD6 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related FXYD6 Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-59004PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FXYD6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FXYD6.

Source: E. coli

Amino Acid Sequence: CKCSFNQKPRAPGDEEAQVENLITANATEP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FXYD6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-59004.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FXYD6 Recombinant Protein Antigen

  • FXYD domain containing ion transport regulator 6
  • FXYD domain-containing ion transport regulator 6
  • phosphohippolin

Background

This reference sequence was derived from multiple replicate ESTs and validated by human genomic sequence. This geneencodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain,beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved humangene nomenclature for the family is FXYD-domain containing ion transport regulator. FXYD2, also known as the gammasubunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3(MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems.Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminusextracellular and the C-terminus on the cytoplasmic side of the membrane. This gene product, FXYD6, is novel and hasnot been characterized as a protein. Multiple alternatively spliced transcript variants that encode the same proteinisoform have been described. RefSeq curation by Kathleen J. Sweadner, Ph.D., sweadner@helix.mgh.harvard.edu.)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-47156
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
AF7947
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Simple Western, WB
NLS6731
Species: Bv, Ca, Eq, Gt, Ha, Hu, Pm, Po, Pm, Rb, Rt, Xp
Applications: IHC,  IHC-P
AF2569
Species: Hu
Applications: ICC, WB
NBP1-89296
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-22238
Species: Hu, Mu
Applications: IP, WB
NBP1-83619
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
MAB4614
Species: Hu
Applications: CyTOF-ready, Flow, KO
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NBP1-97768
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
NBP2-33903
Species: Hu
Applications: IHC,  IHC-P
NBP2-88493
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-62725
Species: Hu
Applications: IHC,  IHC-P
NBP3-03243
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF5375
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
MAB1233
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
NB100-1020
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP2-81950
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00001428-M03
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, IP, WB
NBP2-59004PEP
Species: Hu
Applications: AC

Publications for FXYD6 Recombinant Protein Antigen (NBP2-59004PEP) (0)

There are no publications for FXYD6 Recombinant Protein Antigen (NBP2-59004PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FXYD6 Recombinant Protein Antigen (NBP2-59004PEP) (0)

There are no reviews for FXYD6 Recombinant Protein Antigen (NBP2-59004PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FXYD6 Recombinant Protein Antigen (NBP2-59004PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FXYD6 Products

Blogs on FXYD6

There are no specific blogs for FXYD6, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FXYD6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FXYD6