FXYD6 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: FXYD6 Antibody [NBP2-59004] - Staining of human cell line RH-30 shows localization to nucleoplasm & cytosol.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FXYD6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FXYD6 Antibody - BSA Free (NBP2-59004) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CKCSFNQKPRAPGDEEAQVENLITANATEP
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FXYD6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FXYD6 Recombinant Protein Antigen (NBP2-59004PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FXYD6 Antibody - BSA Free

• FXYD domain containing ion transport regulator 6
• FXYD domain-containing ion transport regulator 6
• phosphohippolin

Background

This reference sequence was derived from multiple replicate ESTs and validated by human genomic sequence. This geneencodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain,beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved humangene nomenclature for the family is FXYD-domain containing ion transport regulator. FXYD2, also known as the gammasubunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3(MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems.Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminusextracellular and the C-terminus on the cytoplasmic side of the membrane. This gene product, FXYD6, is novel and hasnot been characterized as a protein. Multiple alternatively spliced transcript variants that encode the same proteinisoform have been described. RefSeq curation by Kathleen J. Sweadner, Ph.D., sweadner@helix.mgh.harvard.edu.)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FXYD6